Remove Brotli from Source/ThirdParty
authorfred.wang@free.fr <fred.wang@free.fr@268f45cc-cd09-0410-ab3c-d52691b4dbfc>
Thu, 5 Oct 2017 09:32:58 +0000 (09:32 +0000)
committerfred.wang@free.fr <fred.wang@free.fr@268f45cc-cd09-0410-ab3c-d52691b4dbfc>
Thu, 5 Oct 2017 09:32:58 +0000 (09:32 +0000)
https://bugs.webkit.org/show_bug.cgi?id=177804

Patch by Frederic Wang <fwang@igalia.com> on 2017-10-03
Reviewed by Michael Catanzaro.

.:

* Source/CMakeLists.txt: Do not build ThirdParty/brotli anymore.
* Source/cmake/FindBrotliDec.cmake: Added. New cmake module to find Brotli via PkgConfig.
* Source/cmake/OptionsGTK.cmake: Expose USE_WOFF2 as a public option and use find_package
to look for brotli.

Source/ThirdParty:

* brotli/CMakeLists.txt: Removed.
* brotli/LICENSE: Removed.
* brotli/README.webkit: Removed.
* brotli/common/constants.h: Removed.
* brotli/common/dictionary.bin: Removed.
* brotli/common/dictionary.c: Removed.
* brotli/common/dictionary.h: Removed.
* brotli/common/version.h: Removed.
* brotli/dec/bit_reader.c: Removed.
* brotli/dec/bit_reader.h: Removed.
* brotli/dec/context.h: Removed.
* brotli/dec/decode.c: Removed.
* brotli/dec/huffman.c: Removed.
* brotli/dec/huffman.h: Removed.
* brotli/dec/port.h: Removed.
* brotli/dec/prefix.h: Removed.
* brotli/dec/state.c: Removed.
* brotli/dec/state.h: Removed.
* brotli/dec/transform.h: Removed.
* brotli/include/brotli/decode.h: Removed.
* brotli/include/brotli/encode.h: Removed.
* brotli/include/brotli/port.h: Removed.
* brotli/include/brotli/types.h: Removed.
* brotli/update.sh: Removed.
* woff2/CMakeLists.txt: Use Brotli's include and library paths found by CMake.

Tools:

* gtk/jhbuild.modules: Build brotli 1.0.1 from the official github repository.
* Scripts/webkitpy/style/checker.py: Remove brotli.

git-svn-id: https://svn.webkit.org/repository/webkit/trunk@222907 268f45cc-cd09-0410-ab3c-d52691b4dbfc

33 files changed:
ChangeLog
Source/CMakeLists.txt
Source/ThirdParty/ChangeLog
Source/ThirdParty/brotli/CMakeLists.txt [deleted file]
Source/ThirdParty/brotli/LICENSE [deleted file]
Source/ThirdParty/brotli/README.webkit [deleted file]
Source/ThirdParty/brotli/common/constants.h [deleted file]
Source/ThirdParty/brotli/common/dictionary.bin [deleted file]
Source/ThirdParty/brotli/common/dictionary.c [deleted file]
Source/ThirdParty/brotli/common/dictionary.h [deleted file]
Source/ThirdParty/brotli/common/version.h [deleted file]
Source/ThirdParty/brotli/dec/bit_reader.c [deleted file]
Source/ThirdParty/brotli/dec/bit_reader.h [deleted file]
Source/ThirdParty/brotli/dec/context.h [deleted file]
Source/ThirdParty/brotli/dec/decode.c [deleted file]
Source/ThirdParty/brotli/dec/huffman.c [deleted file]
Source/ThirdParty/brotli/dec/huffman.h [deleted file]
Source/ThirdParty/brotli/dec/port.h [deleted file]
Source/ThirdParty/brotli/dec/prefix.h [deleted file]
Source/ThirdParty/brotli/dec/state.c [deleted file]
Source/ThirdParty/brotli/dec/state.h [deleted file]
Source/ThirdParty/brotli/dec/transform.h [deleted file]
Source/ThirdParty/brotli/include/brotli/decode.h [deleted file]
Source/ThirdParty/brotli/include/brotli/encode.h [deleted file]
Source/ThirdParty/brotli/include/brotli/port.h [deleted file]
Source/ThirdParty/brotli/include/brotli/types.h [deleted file]
Source/ThirdParty/brotli/update.sh [deleted file]
Source/ThirdParty/woff2/CMakeLists.txt
Source/cmake/FindBrotliDec.cmake [new file with mode: 0644]
Source/cmake/OptionsGTK.cmake
Tools/ChangeLog
Tools/Scripts/webkitpy/style/checker.py
Tools/gtk/jhbuild.modules

index e63dd3a..76ded1d 100644 (file)
--- a/ChangeLog
+++ b/ChangeLog
@@ -1,3 +1,15 @@
+2017-10-03  Frederic Wang  <fwang@igalia.com>
+
+        Remove Brotli from Source/ThirdParty
+        https://bugs.webkit.org/show_bug.cgi?id=177804
+
+        Reviewed by Michael Catanzaro.
+
+        * Source/CMakeLists.txt: Do not build ThirdParty/brotli anymore.
+        * Source/cmake/FindBrotliDec.cmake: Added. New cmake module to find Brotli via PkgConfig.
+        * Source/cmake/OptionsGTK.cmake: Expose USE_WOFF2 as a public option and use find_package
+        to look for brotli.
+
 2017-10-05  Yusuke Suzuki  <utatane.tea@gmail.com>
 
         [Linux] Port MallocBench
index 31fcd89..d4dfebc 100644 (file)
@@ -18,7 +18,6 @@ if (ENABLE_API_TESTS)
 endif ()
 
 if (USE_WOFF2)
-    add_subdirectory(ThirdParty/brotli)
     add_subdirectory(ThirdParty/woff2)
 endif ()
 
index 74689d0..31aef53 100644 (file)
@@ -1,3 +1,36 @@
+2017-10-03  Frederic Wang  <fwang@igalia.com>
+
+        Remove Brotli from Source/ThirdParty
+        https://bugs.webkit.org/show_bug.cgi?id=177804
+
+        Reviewed by Michael Catanzaro.
+
+        * brotli/CMakeLists.txt: Removed.
+        * brotli/LICENSE: Removed.
+        * brotli/README.webkit: Removed.
+        * brotli/common/constants.h: Removed.
+        * brotli/common/dictionary.bin: Removed.
+        * brotli/common/dictionary.c: Removed.
+        * brotli/common/dictionary.h: Removed.
+        * brotli/common/version.h: Removed.
+        * brotli/dec/bit_reader.c: Removed.
+        * brotli/dec/bit_reader.h: Removed.
+        * brotli/dec/context.h: Removed.
+        * brotli/dec/decode.c: Removed.
+        * brotli/dec/huffman.c: Removed.
+        * brotli/dec/huffman.h: Removed.
+        * brotli/dec/port.h: Removed.
+        * brotli/dec/prefix.h: Removed.
+        * brotli/dec/state.c: Removed.
+        * brotli/dec/state.h: Removed.
+        * brotli/dec/transform.h: Removed.
+        * brotli/include/brotli/decode.h: Removed.
+        * brotli/include/brotli/encode.h: Removed.
+        * brotli/include/brotli/port.h: Removed.
+        * brotli/include/brotli/types.h: Removed.
+        * brotli/update.sh: Removed.
+        * woff2/CMakeLists.txt: Use Brotli's include and library paths found by CMake.
+
 2017-10-05  Frederic Wang  <fwang@igalia.com>
 
         Upgrade Brotli to version 1.0.1 and WOFF2 to latest upstream
diff --git a/Source/ThirdParty/brotli/CMakeLists.txt b/Source/ThirdParty/brotli/CMakeLists.txt
deleted file mode 100644 (file)
index 6f8e677..0000000
+++ /dev/null
@@ -1,24 +0,0 @@
-set(BROTLI_DIR "${THIRDPARTY_DIR}/brotli")
-
-set(BROTLI_INCLUDE_DIRECTORIES
-  "${BROTLI_DIR}/common"
-  "${BROTLI_DIR}/dec"
-  "${BROTLI_DIR}/include"
-)
-
-set(BROTLI_SOURCES
-    ${BROTLI_DIR}/common/dictionary.c
-    ${BROTLI_DIR}/dec/bit_reader.c
-    ${BROTLI_DIR}/dec/decode.c
-    ${BROTLI_DIR}/dec/huffman.c
-    ${BROTLI_DIR}/dec/state.c
-)
-
-include_directories("${BROTLI_INCLUDE_DIRECTORIES}")
-add_definitions(-DBROTLI_BUILD_PORTABLE)
-add_library(brotli STATIC ${BROTLI_SOURCES})
-
-if (COMPILER_IS_GCC_OR_CLANG)
-    WEBKIT_ADD_TARGET_C_FLAGS(brotli -Wno-cast-align
-                                     -Wno-implicit-fallthrough)
-endif ()
diff --git a/Source/ThirdParty/brotli/LICENSE b/Source/ThirdParty/brotli/LICENSE
deleted file mode 100644 (file)
index 6298a5d..0000000
+++ /dev/null
@@ -1,19 +0,0 @@
-Copyright (c) 2009, 2010, 2013-2015 by the Brotli Authors.
-
-Permission is hereby granted, free of charge, to any person obtaining a copy
-of this software and associated documentation files (the "Software"), to deal
-in the Software without restriction, including without limitation the rights
-to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-copies of the Software, and to permit persons to whom the Software is
-furnished to do so, subject to the following conditions:
-
-The above copyright notice and this permission notice shall be included in
-all copies or substantial portions of the Software.
-
-THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.  IN NO EVENT SHALL THE
-AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-THE SOFTWARE.
diff --git a/Source/ThirdParty/brotli/README.webkit b/Source/ThirdParty/brotli/README.webkit
deleted file mode 100644 (file)
index e9f8bb5..0000000
+++ /dev/null
@@ -1,17 +0,0 @@
-This is the Brotli data compression library from
-https://github.com/google/brotli.
-
-Currently, we import only the Brotli decoder (the /dec/ subdirectory), not the
-encoder (/enc/ subdirectory).
-
-Upstream code can be viewed at
-  https://github.com/google/brotli/tree/master/dec
-
-and cloned by
-  git clone https://github.com/google/brotli
-
-The in-tree copy is updated by running
-  sh update.sh
-from within the modules/brotli directory.
-
-Current version: [commit 4f8cd4c0f4443d51a9603790a445b06c073b7a4d].
diff --git a/Source/ThirdParty/brotli/common/constants.h b/Source/ThirdParty/brotli/common/constants.h
deleted file mode 100644 (file)
index 416ec55..0000000
+++ /dev/null
@@ -1,57 +0,0 @@
-/* Copyright 2016 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-#ifndef BROTLI_COMMON_CONSTANTS_H_
-#define BROTLI_COMMON_CONSTANTS_H_
-
-/* Specification: 7.3. Encoding of the context map */
-#define BROTLI_CONTEXT_MAP_MAX_RLE 16
-
-/* Specification: 2. Compressed representation overview */
-#define BROTLI_MAX_NUMBER_OF_BLOCK_TYPES 256
-
-/* Specification: 3.3. Alphabet sizes: insert-and-copy length */
-#define BROTLI_NUM_LITERAL_SYMBOLS 256
-#define BROTLI_NUM_COMMAND_SYMBOLS 704
-#define BROTLI_NUM_BLOCK_LEN_SYMBOLS 26
-#define BROTLI_MAX_CONTEXT_MAP_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + \
-                                        BROTLI_CONTEXT_MAP_MAX_RLE)
-#define BROTLI_MAX_BLOCK_TYPE_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + 2)
-
-/* Specification: 3.5. Complex prefix codes */
-#define BROTLI_REPEAT_PREVIOUS_CODE_LENGTH 16
-#define BROTLI_REPEAT_ZERO_CODE_LENGTH 17
-#define BROTLI_CODE_LENGTH_CODES (BROTLI_REPEAT_ZERO_CODE_LENGTH + 1)
-/* "code length of 8 is repeated" */
-#define BROTLI_INITIAL_REPEATED_CODE_LENGTH 8
-
-/* Specification: 4. Encoding of distances */
-#define BROTLI_NUM_DISTANCE_SHORT_CODES 16
-#define BROTLI_MAX_NPOSTFIX 3
-#define BROTLI_MAX_NDIRECT 120
-#define BROTLI_MAX_DISTANCE_BITS 24U
-/* BROTLI_NUM_DISTANCE_SYMBOLS == 520 */
-#define BROTLI_NUM_DISTANCE_SYMBOLS (BROTLI_NUM_DISTANCE_SHORT_CODES + \
-                                     BROTLI_MAX_NDIRECT +              \
-                                     (BROTLI_MAX_DISTANCE_BITS <<      \
-                                      (BROTLI_MAX_NPOSTFIX + 1)))
-/* Distance that is guaranteed to be representable in any stream. */
-#define BROTLI_MAX_DISTANCE 0x3FFFFFC
-
-/* 7.1. Context modes and context ID lookup for literals */
-/* "context IDs for literals are in the range of 0..63" */
-#define BROTLI_LITERAL_CONTEXT_BITS 6
-
-/* 7.2. Context ID for distances */
-#define BROTLI_DISTANCE_CONTEXT_BITS 2
-
-/* 9.1. Format of the Stream Header */
-/* Number of slack bytes for window size. Don't confuse
-   with BROTLI_NUM_DISTANCE_SHORT_CODES. */
-#define BROTLI_WINDOW_GAP 16
-#define BROTLI_MAX_BACKWARD_LIMIT(W) (((size_t)1 << (W)) - BROTLI_WINDOW_GAP)
-
-#endif  /* BROTLI_COMMON_CONSTANTS_H_ */
diff --git a/Source/ThirdParty/brotli/common/dictionary.bin b/Source/ThirdParty/brotli/common/dictionary.bin
deleted file mode 100755 (executable)
index a585c0e..0000000
+++ /dev/null
@@ -1,432 +0,0 @@
-timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$('#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$("#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS"agedgreyGET"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:å*/\r
- 100hall.
-
-A7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,\r
-\r
-coolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px''););">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarmâ\80\99sboys[0].');"POSTbearkids);}}marytend(UK)quadzh:æ-siz----prop');\rliftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene â\80\94softrometillross<h3>pourfadepink<tr>mini)|!(minezh:èbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json', 'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:ä'));puremageparatonebond:37Z_of_']);000,zh:çtankyardbowlbush:56ZJava30px
-|}
-%C3%:34ZjeffEXPIcashvisagolfsnowzh:équer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;
-}
-exit:35Zvarsbeat'});diet999;anne}}</[i].Langkm²wiretoysaddssealalex;
-       }echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$('.50pxPh.Dmiscalanloandeskmileryanunixdisc);}
-dustclip).
-
-70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}\r
-HEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-
-!002)ndow[1];[];
-Log salt\r
-               bangtrimbath){\r
-00px
-});ko:ìfeesad>\rs:// [];tollplug(){
-{\r
- .js'200pdualboat.JPG);
-}quot);
-
-');
-\r
-}\r201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomásesteestaperotodohacecadaañobiendíaasívidacasootroforosolootracualdijosidograntipotemadebealgoquéestonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiзанаомрарутанепоотизнодотожеонихНаеебымыВысовывоНообПолиниРФНеМытыОнимдаЗаДаНуОбтеИзейнуммТыужفيأنمامعكلأورديافىهولملكاولهبسالإنهيأيقدهلثمبهلوليبلايبكشيامأمنتبيلنحبهممشوشfirstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow">genretrucklooksValueFrame.net/-->
-<try {
-var makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top">
-<!--POST"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url="parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();" Blocklinuxjonespixel');">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar">.src=toweralt="cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});\r
-bandsqueue= {};80px;cking{\r
-               aheadclockirishlike ratiostatsForm"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg"spainbeachtaxesmicroangel--></giftssteve-linkbody.});
-       mount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:ã\82simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/"1.jpgwmodeparamSTARTleft idden, 201);
-}
-form.viruschairtransworstPagesitionpatch<!--
-o-cacfirmstours,000 asiani++){adobe')[0]id=10both;menu .2.mi.png"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120" sweettr>\r
-name=diegopage swiss-->
-
-#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:ã\83id="cName"worseshots-box-delta
-&lt;bears:48Z<data-rural</a> spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe<img img">, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknows</h5>faq">zh-cn10);
--1");type=bluestrulydavis.js';>\r
-<!steel you h2>\r
-form jesus100% menu.\r
-       \r
-walesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeañosestátienehastaotrospartedondenuevohacerformamismomejormundoaquídíassóloayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaísnuevasaludforosmedioquienmesespoderchileserávecesdecirjoséestarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocómoenerojuegoperúhaberestoynuncamujervalorfueralibrogustaigualvotoscasosguíapuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleónplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenáreadiscopedrocercapuedapapelmenorútilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniñoquedapasarbancohijosviajepabloéstevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallíjovendichaestantalessalirsuelopesosfinesllamabuscoéstalleganegroplazahumorpagarjuntadobleislasbolsabañohablaluchaÁreadicenjugarnotasvalleallácargadolorabajoestégustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename="amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.
-
-Onejoinedmenu">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo">beyond-scaleacceptservedmarineFootercamera</h1>
-_form"leavesstress" />\r
-.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop"><racingresize--&gt;pacitysexualbureau.jpg" 10,000obtaintitlesamount, Inc.comedymenu" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body">
-* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox">
-System DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String
-
-Whiltaylorclear:resortfrenchthough") + "<body>buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink">Images=falsewhile hspace0&amp; 
-
-In  powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml"  rights.html-blockregExp:hoverwithinvirginphones</tr>\rusing 
-       var >');
-       </td>
-</tr>
-bahasabrasilgalegomagyarpolskisrpskiردو中文简体繁體信息中国我们一个公司管理论坛可以服务时间个人产品自己企业查看工作联系没有网站所有评论中心文章用户首页作者技术问题相关下载搜索使用软件在线主题资料视频回复注册网络收藏内容推荐市场消息空间发布什么好友生活图片发展如果手机新闻最新方式北京提供关于更多这个系统知道游戏广告其他发表安全第一会员进行点击版权电子世界设计免费教育加入活动他们商品博客现在上海如何已经留言详细社区登录本站需要价格支持国际链接国家建设朋友阅读法律位置经济选择这样当前分类排行因为交易最后音乐不能通过行业科技可能设备合作大家社会研究专业全部项目这里还是开始情况电脑文件品牌帮助文化资源大学学习地址浏览投资工程要求怎么时候功能主要目前资讯城市方法电影招聘声明任何健康数据美国汽车介绍但是交流生产所以电话显示一些单位人员分析地图旅游工具学生系列网友帖子密码频道控制地区基本全国网上重要第二喜欢进入友情这些考试发现培训以上政府成为环境香港同时娱乐发送一定开发作品标准欢迎解决地方一下以及责任或者客户代表积分女人数码销售出现离线应用列表不同编辑统计查询不要有关机构很多播放组织政策直接能力来源時間看到热门关键专区非常英语百度希望美女比较知识规定建议部门意见精彩日本提高发言方面基金处理权限影片银行还有分享物品经营添加专家这种话题起来业务公告记录简介质量男人影响引用报告部分快速咨询时尚注意申请学校应该历史只是返回购买名称为了成功说明供应孩子专题程序一般會員只有其它保护而且今天窗口动态状态特别认为必须更新小说我們作为媒体包括那么一样国内是否根据电视学院具有过程由于人才出来不过正在明星故事关系标题商务输入一直基础教学了解建筑结果全球通知计划对于艺术相册发生真的建立等级类型经验实现制作来自标签以下原创无法其中個人一切指南关闭集团第三关注因此照片深圳商业广州日期高级最近综合表示专辑行为交通评价觉得精华家庭完成感觉安装得到邮件制度食品虽然转载报价记者方案行政人民用品东西提出酒店然后付款热点以前完全发帖设置领导工业医院看看经典原因平台各种增加材料新增之后职业效果今年论文我国告诉版主修改参与打印快乐机械观点存在精神获得利用继续你们这么模式语言能够雅虎操作风格一起科学体育短信条件治疗运动产业会议导航先生联盟可是問題结构作用调查資料自动负责农业访问实施接受讨论那个反馈加强女性范围服務休闲今日客服觀看参加的话一点保证图书有效测试移动才能决定股票不断需求不得办法之间采用营销投诉目标爱情摄影有些複製文学机会数字装修购物农村全面精品其实事情水平提示上市谢谢普通教师上传类别歌曲拥有创新配件只要时代資訊达到人生订阅老师展示心理贴子網站主題自然级别简单改革那些来说打开代码删除证券节目重点次數多少规划资金找到以后大全主页最佳回答天下保障现代检查投票小时沒有正常甚至代理目录公开复制金融幸福版本形成准备行情回到思想怎样协议认证最好产生按照服装广东动漫采购新手组图面板参考政治容易天地努力人们升级速度人物调整流行造成文字韩国贸易开展相關表现影视如此美容大小报道条款心情许多法规家居书店连接立即举报技巧奥运登入以来理论事件自由中华办公妈妈真正不错全文合同价值别人监督具体世纪团队创业承担增长有人保持商家维修台湾左右股份答案实际电信经理生命宣传任务正式特色下来协会只能当然重新內容指导运行日志賣家超过土地浙江支付推出站长杭州执行制造之一推广现场描述变化传统歌手保险课程医疗经过过去之前收入年度杂志美丽最高登陆未来加工免责教程版块身体重庆出售成本形式土豆出價东方邮箱南京求职取得职位相信页面分钟网页确定图例网址积极错误目的宝贝机关风险授权病毒宠物除了評論疾病及时求购站点儿童每天中央认识每个天津字体台灣维护本页个性官方常见相机战略应当律师方便校园股市房屋栏目员工导致突然道具本网结合档案劳动另外美元引起改变第四会计說明隐私宝宝规范消费共同忘记体系带来名字發表开放加盟受到二手大量成人数量共享区域女孩原则所在结束通信超级配置当时优秀性感房产遊戲出口提交就业保健程度参数事业整个山东情感特殊分類搜尋属于门户财务声音及其财经坚持干部成立利益考虑成都包装用戶比赛文明招商完整真是眼睛伙伴威望领域卫生优惠論壇公共良好充分符合附件特点不可英文资产根本明显密碼公众民族更加享受同学启动适合原来问答本文美食绿色稳定终于生物供求搜狐力量严重永远写真有限竞争对象费用不好绝对十分促进点评影音优势不少欣赏并且有点方向全新信用设施形象资格突破随着重大于是毕业智能化工完美商城统一出版打造產品概况用于保留因素中國存储贴图最愛长期口价理财基地安排武汉里面创建天空首先完善驱动下面不再诚信意义阳光英国漂亮军事玩家群众农民即可名稱家具动画想到注明小学性能考研硬件观看清楚搞笑首頁黄金适用江苏真实主管阶段註冊翻译权利做好似乎通讯施工狀態也许环保培养概念大型机票理解匿名cuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestánnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegúnbuenosvolverpuntossemanahabíaagostonuevosunidoscarlosequiponiñosmuchosalgunacorreoimagenpartirarribamaríahombreempleoverdadcambiomuchasfueronpasadolíneaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposseráneuropamediosfrenteacercademásofertacochesmodeloitalialetrasalgúncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrápuestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosúnicocaminositiosrazóndebidopruebatoledoteníajesúsesperococinaorigentiendacientocádizhablarseríalatinafuerzaestiloguerraentraréxitolópezagendavídeoevitarpaginametrosjavierpadresfácilcabezaáreassalidaenvíojapónabusosbienestextosllevarpuedanfuertecomúnclaseshumanotenidobilbaounidadestáseditarcreadoдлячтокакилиэтовсеегопритакещеужеКакбезбылониВсеподЭтотомчемнетлетразонагдемнеДляПринаснихтемктогодвоттамСШАмаяЧтовасвамемуТакдванамэтиэтуВамтехпротутнаддняВоттринейВаснимсамтотрубОнимирнееОООлицэтаОнанемдоммойдвеоносудकेहैकीसेकाकोऔरपरनेएककिभीइसकरतोहोआपहीयहयातकथाjagranआजजोअबदोगईजागएहमइनवहयेथेथीघरजबदीकईजीवेनईनएहरउसमेकमवोलेसबमईदेओरआमबसभरबनचलमनआगसीलीعلىإلىهذاآخرعددالىهذهصورغيركانولابينعرضذلكهنايومقالعليانالكنحتىقبلوحةاخرفقطعبدركنإذاكمااحدإلافيهبعضكيفبحثومنوهوأناجدالهاسلمعندليسعبرصلىمنذبهاأنهمثلكنتالاحيثمصرشرححولوفياذالكلمرةانتالفأبوخاصأنتانهاليعضووقدابنخيربنتلكمشاءوهيابوقصصومارقمأحدنحنعدمرأياحةكتبدونيجبمنهتحتجهةسنةيتمكرةغزةنفسبيتللهلناتلكقلبلماعنهأولشيءنورأمافيكبكلذاترتببأنهمسانكبيعفقدحسنلهمشعرأهلشهرقطرطلبprofileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>\r
-wrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1']);
-confirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.
-
-The but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to  AugustsymbolsCompanymattersmusicalagainstserving})();\r
-paymenttroubleconceptcompareparentsplayersregionsmonitor ''The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen
-
-When observe</h2>\r
-Modern provide" alt="borders.
-
-For 
-
-Many artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>\r
- Countryignoredloss ofjust asGeorgiastrange<head><stopped1']);\r
-islandsnotableborder:list ofcarried100,000</h3>
- severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})();
-
-burningoperatedegreessource=Richardcloselyplasticentries</tr>\r
-color:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br />
-: true,chartertourismclassicproceedexplain</h1>\r
-online.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and  width=e&quot;tradingleft">
-personsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy
-               <!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| [];
-DATA[ *kitchenmountedactual dialectmainly _blank'installexpertsif(typeIt also&copy; ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in
-       <!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday's.html" target=wearingAll Rig;
-})();raising Also, crucialabout">declare-->
-<scfirefoxas muchappliesindex, s, but type = 
-\r
-<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>\r
- returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of
-
-Some 'click'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu">
-monthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>
-evidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>
- he left).val()false);logicalbankinghome tonaming Arizonacredits);
-});
-founderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered']);
-  has theunclearEvent',both innot all
-
-<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&amp;as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong  simple}catch(seventhinfoboxwent topaintedcitizenI don'tretreat. Some ww.");
-bombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>
-
-. When in bothdismissExplorealways via thespañolwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>
-               it intoranked rate oful>\r
-  attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture-->\r
-\r
- rows=" objectinverse<footerCustomV><\/scrsolvingChamberslaverywoundedwhereas!= 'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead')[0Criticsstudios>&copy;group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr'+'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" />
-               here isencoded.  The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();
- is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of});\r
-  immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0];
-  it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in']);\r
-  marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = 'make a securedBaptistvoting 
-               var March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header
-<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;">\r
-pushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>
-people.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />\r
-AtlantanucleusCounty,purely count">easily build aonclicka givenpointerh&quot;events else {
-ditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a >\r
-\r
-\r
-market.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks">
-();" rea place\u003Caabout atr>\r
-               ccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>\r
-<ustomVa;&gt;</importsor thatmostly &amp;re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>\r
-\r
-<!organis <br />Beijingcatalàdeutscheuropeueuskaragaeilgesvenskaespañamensajeusuariotrabajoméxicopáginasiempresistemaoctubreduranteañadirempresamomentonuestroprimeratravésgraciasnuestraprocesoestadoscalidadpersonanúmeroacuerdomúsicamiembroofertasalgunospaísesejemploderechoademásprivadoagregarenlacesposiblehotelessevillaprimeroúltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseñoturismocódigoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastítuloconocersegundoconsejofranciaminutossegundatenemosefectosmálagasesiónrevistagranadacompraringresogarcíaacciónecuadorquienesinclusodeberámateriahombresmuestrapodríamañanaúltimaestamosoficialtambienningúnsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern  title="LocationcontractvisitorsDownloadwithout right">
-measureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2>
-  keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" (&quot;graduate</head>
-commercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>
-               <select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--&gt;
-
-coveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a>\r
-electricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: 'http:'script'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending&hellip;new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks">
-       <title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"Españolreleasessubmit" er&quot;additionsymptomsorientedresourceright"><pleasurestationshistory.leaving  border=contentscenter">.
-
-Some directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa &quot;allowingDocumentrevision. 
-
-The yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary
-
-After guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>
-       affectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions"campbell<!-- end</span><<br />\r
-_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=" Companyexamples<iframe believespresentsmarshallpart of properly).
-
-The taxonomymuch of </span>
-" data-srtuguêsscrollTo project<head>\r
-attorneyemphasissponsorsfancyboxworld's wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix
-<head>
-article <sectionfindingsrole in popular  Octoberwebsite exposureused to  changesoperatedclickingenteringcommandsinformed numbers  </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript">
-&nbsp;</<tr><td height:2/productcountry include footer" &lt;!-- title"></jquery.</form>
-(简体)(繁體)hrvatskiitalianoromânătürkçeاردوtambiénnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuésdeportesproyectoproductopúbliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniónimprimirmientrasaméricavendedorsociedadrespectorealizarregistropalabrasinterésentoncesespecialmiembrosrealidadcórdobazaragozapáginassocialesbloqueargestiónalquilersistemascienciascompletoversióncompletaestudiospúblicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayoríaalemaniafunciónúltimoshaciendoaquellosediciónfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojóvenesdistritotécnicaconjuntoenergíatrabajarasturiasrecienteutilizarboletínsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallapróximoalmeríaanimalesquiénescorazónsecciónbuscandoopcionesexteriorconceptotodavíagaleríaescribirmedicinalicenciaconsultaaspectoscríticadólaresjusticiadeberánperíodonecesitamantenerpequeñorecibidatribunaltenerifecancióncanariasdescargadiversosmallorcarequieretécnicodeberíaviviendafinanzasadelantefuncionaconsejosdifícilciudadesantiguasavanzadatérminounidadessánchezcampañasoftonicrevistascontienesectoresmomentosfacultadcréditodiversassupuestofactoressegundospequeñaгодаеслиестьбылобытьэтомЕслитогоменявсехэтойдажебылигодуденьэтотбыласебяодинсебенадосайтфотонегосвоисвойигрытожевсемсвоюлишьэтихпокаднейдомамиралиботемухотядвухсетилюдиделомиретебясвоевидечегоэтимсчеттемыценысталведьтемеводытебевышенамитипатомуправлицаоднагодызнаюмогудругвсейидеткиноодноделаделесрокиюнявесьЕстьразанашиاللهالتيجميعخاصةالذيعليهجديدالآنالردتحكمصفحةكانتاللييكونشبكةفيهابناتحواءأكثرخلالالحبدليلدروساضغطتكونهناكساحةناديالطبعليكشكرايمكنمنهاشركةرئيسنشيطماذاالفنشبابتعبررحمةكافةيقولمركزكلمةأحمدقلبييعنيصورةطريقشاركجوالأخرىمعناابحثعروضبشكلمسجلبنانخالدكتابكليةبدونأيضايوجدفريقكتبتأفضلمطبخاكثرباركافضلاحلىنفسهأيامردودأنهاديناالانمعرضتعلمداخلممكن\0\0\0\0\0\0\0\0\ 1\0\ 1\0\ 1\0\ 1\0\ 2\0\ 2\0\ 2\0\ 2\0\ 4\0\ 4\0\ 4\0\ 4\0\0\ 1\ 2\ 3\ 4\ 5\ 6\a\a\ 6\ 5\ 4\ 3\ 2\ 1\0\b      
-\v\f\r\ e\ f\ f\ e\r\f\v
-       \b\10\11\12\13\14\15\16\17\17\16\15\14\13\12\11\10\18\19\1a\e\1c\1d\1e\1f\1f\1e\1d\1c\e\1a\19\18ÿÿÿÿ\0\0\0\0\0\0\0\0ÿÿÿÿ\ 1\0\0\0\ 2\0\0\0\ 2\0\0\0\ 1\0\0\0\ 1\0\0\0\ 3\0\0\0ÿÿ\0\ 1\0\0\0\ 1\0\0ÿÿ\0\ 1\0\0\0\b\0\b\0\b\0\b\0\0\0\ 1\0\ 2\0\ 3\0\ 4\0\ 5\0\ 6\0\aresourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter" value="</select>Australia" class="situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement" title="potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form>\r
-statementattentionBiography} else {
-solutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter">
-exceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFrançaisHollywoodexpansionstandards</style>
-reductionDecember preferredCambridgeopponentsBusiness confusion>
-<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>
-mountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to</title>
-relationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>
-suspectedmargin: 0spiritual</head>
-
-microsoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>
-       sponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered-->\r
-<!--American protectedNovember </style><furnitureInternet  onblur="suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir="ltr"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;
-
-southwestthe rightradiationmay have unescape(spoken in" href="/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>
-came fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8" /><![CDATA[">ContactSouthern bgcolor="series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->
-<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id="precedingTechnicalphysicistoccurs innavigatorsection">span id="sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt="in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id="right">\r
-residenceleave thecontent">are often  })();\r
-probably Professor-button" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor
-&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved
-
-In the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also
-<head>
-<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained"></div>
-</a></td>depend onsearch">
-pieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue="">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.
-
-After , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover" style="states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as  Serviceslocation and oftenmeasuringand it ispaperbackvalues of\r
-<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href="y:inline;Church ofthe eventvery highofficial -height: content="/cgi-bin/to createafrikaansesperantofrançaislatviešulietuviųČeštinačeštinaไทย日本語简体字繁體字한국어为什么计算机笔记本討論區服务器互联网房地产俱乐部出版社排行榜部落格进一步支付宝验证码委员会数据库消费者办公室讨论区深圳市播放器北京市大学生越来越管理员信息网serviciosartículoargentinabarcelonacualquierpublicadoproductospolíticarespuestawikipediasiguientebúsquedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciónnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomíaimágenescontactardescargarnecesarioatenciónteléfonocomisióncancionescapacidadencontraranálisisfavoritostérminosprovinciaetiquetaselementosfuncionesresultadocarácterpropiedadprincipionecesidadmunicipalcreacióndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzálezdocumentopelícularecientesgeneralestarragonaprácticanovedadespropuestapacientestécnicasobjetivoscontactosमेंलिएहैंगयासाथएवंरहेकोईकुछरहाबादकहासभीहुएरहीमैंदिनबातdiplodocsसमयरूपनामपताफिरऔसततरहलोगहुआबारदेशहुईखेलयदिकामवेबतीनबीचमौतसाललेखजॉबमददतथानहीशहरअलगकभीनगरपासरातकिएउसेगयीहूँआगेटीमखोजकारअभीगयेतुमवोटदेंअगरऐसेमेललगाहालऊपरचारऐसादेरजिसदिलबंदबनाहूंलाखजीतबटनमिलइसेआनेनयाकुललॉगभागरेलजगहरामलगेपेजहाथइसीसहीकलाठीकहाँदूरतहतसातयादआयापाककौनशामदेखयहीरायखुदलगीcategoriesexperience</title>\r
-Copyright javascriptconditionseverything<p class="technologybackground<a class="management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox" techniquesprotectionapparentlyas well asunt', 'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor="#especially content="productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=".indexOf("conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus="<form id="processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png" (document,boundariesexpressionsettlementBackgroundout of theenterprise("https:" unescape("password" democratic<a href="/wrapper">
-membershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick="considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic" height="link rel=".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class="0px;marginmechanicalstatisticscelebratedGovernment
-
-During tdevelopersartificialequivalentoriginatedCommissionattachment<span id="there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang="en" </style>\r
-absolute; supportingextremely mainstream</strong> popularityemployment</table>\r
- colspan="</form>
-  conversionabout the </p></div>integrated" lang="enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class="<a title="(includingparametersprohibited= "http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0" class="completelyillustratefive yearsinstrumentPublishing1" class="psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;
-function it was theConventionautomobileProtestantaggressiveafter the Similarly," /></div>collection\r
-functionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>
-</.indexOf('i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }
-</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt="adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css"     function innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>
-       diplomaticcontainingperformingextensionsmay not beconcept of onclick="It is alsofinancial making theLuxembourgadditionalare calledengaged in"script");but it waselectroniconsubmit="
-<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences
-</head>\r
-recognisedinitializelimited toAlexandriaretirementAdventuresfour years
-
-&lt;!-- increasingdecorationh3 class="origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews" width="1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class="Scientificclass="no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional
-<head>
-<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix">the publicmany yearswhich wereover time,synonymouscontent">
-presumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan="only a fewmeant thatled to the-->\r
-<div <fieldset>Archbishop class="nobeing usedapproachesprivilegesnoscript>
-results inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript>\r/index.phparrival of-jssdk'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>
-               complaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>
-percentagebest-knowncreating a" dir="ltrLieutenant
-<div id="they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.
-
-In the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/" class="geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid="searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured">is said tostructuralreferendummost oftena separate->
-<div id Official worldwide.aria-labelthe planetand it wasd" value="looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id="opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/" title=".com/indextaking thepittsburghcontent">\r<script>(fturned outhaving the</span>\r
- occasionalbecause itstarted tophysically></div>
-  created byCurrently, bgcolor="tabindex="disastrousAnalytics also has a><div id="</style>
-<called forsinger and.src = "//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguêsעבריתفارسیdesarrollocomentarioeducaciónseptiembreregistradodirecciónubicaciónpublicidadrespuestasresultadosimportantereservadosartículosdiferentessiguientesrepúblicasituaciónministerioprivacidaddirectorioformaciónpoblaciónpresidentecontenidosaccesoriostechnoratipersonalescategoríaespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolíticasanterioresdocumentosnaturalezamaterialesdiferenciaeconómicatransporterodríguezparticiparencuentrandiscusiónestructurafundaciónfrecuentespermanentetotalmenteможнобудетможетвремятакжечтобыболееоченьэтогокогдапослевсегосайтечерезмогутсайтажизнимеждубудутПоискздесьвидеосвязинужносвоейлюдейпорномногодетейсвоихправатакойместоимеетжизньоднойлучшепередчастичастьработновыхправособойпотомменеечисленовыеуслугоколоназадтакоетогдапочтиПослетакиеновыйстоиттакихсразуСанктфорумКогдакнигислованашейнайтисвоимсвязьлюбойчастосредиКромеФорумрынкесталипоисктысячмесяццентртрудасамыхрынкаНовыйчасовместафильммартастранместетекстнашихминутимениимеютномергородсамомэтомуконцесвоемкакойАрхивمنتدىإرسالرسالةالعامكتبهابرامجاليومالصورجديدةالعضوإضافةالقسمالعابتحميلملفاتملتقىتعديلالشعرأخبارتطويرعليكمإرفاقطلباتاللغةترتيبالناسالشيخمنتديالعربالقصصافلامعليهاتحديثاللهمالعملمكتبةيمكنكالطفلفيديوإدارةتاريخالصحةتسجيلالوقتعندمامدينةتصميمأرشيفالذينعربيةبوابةألعابالسفرمشاكلتعالىالأولالسنةجامعةالصحفالدينكلماتالخاصالملفأعضاءكتابةالخيررسائلالقلبالأدبمقاطعمراسلمنطقةالكتبالرجلاشتركالقدميعطيكsByTagName(.jpg" alt="1px solid #.gif" alt="transparentinformationapplication" onclick="establishedadvertising.png" alt="environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright">0" height="even thoughreplacementdestinationCorporation<ul class="AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class="hundreds of
-
-However, compositionclear:both;cooperationwithin the label for="border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength="switzerlandDevelopmentessentially
-
-Although </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics
-       <div id="illustratedengineeringterritoriesauthoritiesdistributed6" height="sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class="more recentit has beeninvasion of).getTime()fundamentalDespite the"><div id="inspirationexaminationpreparationexplanation<input id="</a></span>versions ofinstrumentsbefore the  = 'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content">
-<td class="undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src="/<h1 class="publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=";width:100%independent<h3 class=" onchange=").addClass(interactionOne of the daughter ofaccessoriesbranches of\r
-<div id="the largestdeclarationregulationsInformationtranslationdocumentaryin order to">
-<head>
-<" height="1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class="distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>
-</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>
- selected="high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex="it could be<noscript>
-having been\r
-<head>\r
-< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval"></span></in New Yorkadditional compression
-
-<div id="incorporate;</script><attachEventbecame the " target="_carried outSome of thescience andthe time ofContainer">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>\r
-Continentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel="This is the <a href="/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og="><a class="class="textConversion may be usedmanufactureafter beingclearfix">
-question ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment\r
-</head>\r
-Conversely,>
-<div id="0" width="1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious">this is notthe presentif they areand finallya matter of\r
-       </div>\r
-\r
-</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>
-<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger
-       </script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>
-  they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the></div>\r
-               reflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=""><a href="themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href="/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in                <div id="it" value="language ofas they areproduced inis that theexplain thediv></div>
-However thelead to the <a href="/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenčinacomentariosuniversidadcondicionesactividadesexperienciatecnologíaproducciónpuntuaciónaplicacióncontraseñacategoríasregistrarseprofesionaltratamientoregístratesecretaríaprincipalesprotecciónimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociacióndisponiblesevaluaciónestudiantesresponsableresoluciónguadalajararegistradosoportunidadcomercialesfotografíaautoridadesingenieríatelevisióncompetenciaoperacionesestablecidosimplementeactualmentenavegaciónconformidadline-height:font-family:" : "http://applicationslink" href="specifically//<![CDATA[
-Organizationdistribution0px; height:relationshipdevice-width<div class="<label for="registration</noscript>
-/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name="intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class="organisationcivilization19th centuryarchitectureincorporated20th century-container">most notably/></a></div>notification'undefined')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang="&lt;/sup&gt;dealing withphiladelphiahistorically);</script>
-padding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd">\r
-<htgeographicalConstitution', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style="Encyclopediaiframe src="demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time"><a class="In addition,description+conversationcontact withis generallyr" content="representing&lt;math&gt;presentationoccasionally<img width="navigation">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}
-</script>
-Christianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""><a href="/introductionbelonging toclaimed thatconsequences<meta name="Guide to theoverwhelmingagainst the concentrated,
-.nontouch observations</a>
-</div>
-f (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting>&nbsp;</td>container">
-such as the influence ofa particularsrc='http://navigation" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet       <ul class="installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures
-               <a href="close to theexamples of is about the(see below)." id="searchprofessionalis availablethe official               </script>
-
-               <div id="accelerationthrough the Hall of Famedescriptionstranslationsinterference type='text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the       <li class="instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class="aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc="http://px; height: available tomanufacturerhuman rightslink href="/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>\r
-consider thean estimatedthe National<div id="pagresulting incommissionedanalogous toare required/ul>
-</div>
-was based onand became a&nbsp;&nbsp;t" value="" was capturedno more thanrespectivelycontinue to >\r
-<head>\r
-<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml" title="weight:bold;creating thedisplay:nonereplaced the<img src="/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css" media="People from available onproved to besuggestions"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class="evidence forexplanationsenvironments"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign="top"principle ofat the time,</noscript>\rsaid to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style="input name="the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class="lastworking with'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the
-</script>
-
-an effort toincrease theto the southspacing="0">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>
-thought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds" content="authority ofnorthwestern</div>
-<div "></div>\r
-  consultationcommunity ofthe nationalit should beparticipants align="leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class="splace in thewhere he was<li class="fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class="effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\s+|\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers <link rel="provided thethe story ofcompetitionsenglish (UK)english (US)МонголСрпскисрпскисрпскоلعربية正體中文简体中文繁体中文有限公司人民政府阿里巴巴社会主义操作系统政策法规informaciónherramientaselectrónicodescripciónclasificadosconocimientopublicaciónrelacionadasinformáticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontáctenoshabitacionescumplimientorestaurantesdisposiciónconsecuenciaelectrónicaaplicacionesdesconectadoinstalaciónrealizaciónutilizaciónenciclopediaenfermedadesinstrumentosexperienciasinstituciónparticularessubcategoriaтолькоРоссииработыбольшепростоможетедругихслучаесейчасвсегдаРоссияМоскведругиегородавопросданныхдолжныименноМосквырублейМосквастраныничегоработедолженуслугитеперьОднакопотомуработуапрелявообщеодногосвоегостатьидругойфорумехорошопротивссылкакаждыйвластигруппывместеработасказалпервыйделатьденьгипериодбизнесосновемоменткупитьдолжнарамкахначалоРаботаТолькосовсемвторойначаласписокслужбысистемпечатиновогопомощисайтовпочемупомощьдолжноссылкибыстроданныемногиепроектСейчасмоделитакогоонлайнгородеверсиястранефильмыуровняразныхискатьнеделюянваряменьшемногихданнойзначитнельзяфорумаТеперьмесяцазащитыЛучшиеनहींकरनेअपनेकियाकरेंअन्यक्यागाइडबारेकिसीदियापहलेसिंहभारतअपनीवालेसेवाकरतेमेरेहोनेसकतेबहुतसाइटहोगाजानेमिनटकरताकरनाउनकेयहाँसबसेभाषाआपकेलियेशुरूइसकेघंटेमेरीसकतामेरालेकरअधिकअपनासमाजमुझेकारणहोताकड़ीयहांहोटलशब्दलियाजीवनजाताकैसेआपकावालीदेनेपूरीपानीउसकेहोगीबैठकआपकीवर्षगांवआपकोजिलाजानासहमतहमेंउनकीयाहूदर्जसूचीपसंदसवालहोनाहोतीजैसेवापसजनतानेताजारीघायलजिलेनीचेजांचपत्रगूगलजातेबाहरआपनेवाहनइसकासुबहरहनेइससेसहितबड़ेघटनातलाशपांचश्रीबड़ीहोतेसाईटशायदसकतीजातीवालाहजारपटनारखनेसड़कमिलाउसकीकेवललगताखानाअर्थजहांदेखापहलीनियमबिनाबैंककहींकहनादेताहमलेकाफीजबकितुरतमांगवहींरोज़मिलीआरोपसेनायादवलेनेखाताकरीबउनकाजवाबपूराबड़ासौदाशेयरकियेकहांअकसरबनाएवहांस्थलमिलेलेखकविषयक्रंसमूहथानाتستطيعمشاركةبواسطةالصفحةمواضيعالخاصةالمزيدالعامةالكاتبالردودبرنامجالدولةالعالمالموقعالعربيالسريعالجوالالذهابالحياةالحقوقالكريمالعراقمحفوظةالثانيمشاهدةالمرأةالقرآنالشبابالحوارالجديدالأسرةالعلوممجموعةالرحمنالنقاطفلسطينالكويتالدنيابركاتهالرياضتحياتيبتوقيتالأولىالبريدالكلامالرابطالشخصيسياراتالثالثالصلاةالحديثالزوارالخليجالجميعالعامهالجمالالساعةمشاهدهالرئيسالدخولالفنيةالكتابالدوريالدروساستغرقتصاميمالبناتالعظيمentertainmentunderstanding = function().jpg" width="configuration.png" width="<body class="Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=""><img src="/distinguishedthousands of communicationclear"></div>investigationfavicon.ico" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch" type="form method="as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of" maxlength="return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type="the number ofthe original comprehensiverefers to the</ul>
-</div>
-philosophicallocation.hrefwas publishedSan Francisco(function(){
-<div id="mainsophisticatedmathematical /head>\r
-<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder="; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript" src="/(function() {are available
-       <link rel=" src='http://interested inconventional " alt="" /></are generallyhas also beenmost popular correspondingcredited withtyle="border:</a></span></.gif" width="<iframe src="table class="inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name="or" content="controversialproperty="og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style="known as the shortly afterfor instance,described as /head>
-<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant" border="0">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name="searchattributed tocourse of themathematicianby the end ofat the end of" border="0" technological.removeClass(branch of theevidence that![endif]-->\r
-Institute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href="confused with<link href="/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>
-</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription" determine theavailable forAccording to wide range of   <div class="more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover="because they async = true;problems withseems to havethe result of src="http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld's firstclassified asbottom of the(particularlyalign="left" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout="New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to       <meta name="are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to                <ul class="visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style="equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these
-<div class="input class="replaced withis one of theeducation andinfluenced byreputation as
-<meta name="accommodation</div>
-</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the
-<div style="almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in" value="" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class="mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass="headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;
-</script>
-<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle="marginincluding thebahasa Melayunorsk bokmålnorsk nynorskslovenščinainternacionalcalificacióncomunicaciónconstrucción"><div class="disambiguationDomainName', 'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->
-</><meta name="implementationinfrastructurerepresentationborder-bottom:</head>
-<body>=http%3A%2F%2F<form method="method="post" /favicon.ico" });
-</script>
-.setAttribute(Administration= new Array();<![endif]-->\r
-display:block;Unfortunately,">&nbsp;</div>/favicon.ico">='stylesheet' identification, for example,<li><a href="/an alternativeas a result ofpt"></script>
-type="submit" 
-(function() {recommendationform action="/transformationreconstruction.style.display According to hidden" name="along with thedocument.body.approximately Communicationspost" action="meaning &quot;--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover="the governmenthref="https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->
-
-depends on theUniversity of in contrast to placeholder="in the case ofinternational constitutionalstyle="border-: function() {Because of the-strict.dtd">
-<table class="accompanied byaccount of the<script src="/nature of the the people in in addition tos); js.id = id" width="100%"regarding the Roman Catholican independentfollowing the .gif" width="1the following discriminationarchaeologicalprime minister.js"></script>combination of marginwidth="createElement(w.attachEvent(</a></td></tr>src="https://aIn particular, align="left" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html" title="(function () {comes from theapplication of<span class="sbelieved to beement('script'</a>
-</li>
-<livery different><span class="option value="(also known as    <li><a href="><input name="separated fromreferred to as valign="top">founder of theattempting to carbon dioxide
-
-<div class="class="search-/body>
-</html>opportunity tocommunications</head>\r
-<body style="width:Tiếng Việtchanges in theborder-color:#0" border="0" </span></div><was discovered" type="text" );
-</script>
-
-Department of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>
-
-<div iwas consideredpercent of the" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href='http://whether or notThere are alsothere are manya small numberother parts ofimpossible to  class="buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=" method="post"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign="right">many countriesfor many yearsearliest knownbecause it waspt"></script>\r valign="top" inhabitants offollowing year\r
-<div class="million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style="color:although therebest known forsubmit" name="multiplicationmore than one recognition ofCouncil of theedition of the  <meta name="Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class="descendants of<span class="i align="right"</head>
-<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the   <span class="is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class="<span class="t(Math.random()most prominentdescription ofConstantinoplewere published<div class="seappears in the1" height="1" most importantwhich includeswhich had beendestruction ofthe population
-       <div class="possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle="clear:b\r
-</script>\r
-<was founded ininterview with_id" content="capital of the\r
-<link rel="srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class="cperformance of(function() {\rif and only ifregions of theleading to therelations withUnited Nationsstyle="height:other than theype" content="Association of
-</head>
-<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>
-<link rel=" return false;the purpose ofthe ability to;color:#fff}
-.
-<span class="the subject ofdefinitions of>\r
-<link rel="claim that thehave developed<table width="celebration ofFollowing the to distinguish<span class="btakes place inunder the namenoted that the><![endif]-->
-style="margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id="was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>\r
-\r
-environmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made" src="http://interpreted assecond half ofcrolling="no" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class="footerand especiallytype="button" </span></span>which included>
-<meta name="considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process  <div class="the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class="ptext" name="q"           <div class="the scientificrepresented bymathematicianselected by thethat have been><div class="cdiv id="headerin particular,converted into);
-</script>
-<philosophical srpskohrvatskitiếng ViệtРусскийрусскийinvestigaciónparticipaciónкоторыеобластикоторыйчеловексистемыНовостикоторыхобластьвременикотораясегодняскачатьновостиУкраинывопросыкоторойсделатьпомощьюсредствобразомстороныучастиетечениеГлавнаяисториисистемарешенияСкачатьпоэтомуследуетсказатьтоваровконечнорешениекотороеоргановкоторомРекламаالمنتدىمنتدياتالموضوعالبرامجالمواقعالرسائلمشاركاتالأعضاءالرياضةالتصميمالاعضاءالنتائجالألعابالتسجيلالأقسامالضغطاتالفيديوالترحيبالجديدةالتعليمالأخبارالافلامالأفلامالتاريخالتقنيةالالعابالخواطرالمجتمعالديكورالسياحةعبداللهالتربيةالروابطالأدبيةالاخبارالمتحدةالاغانيcursor:pointer;</title>
-<meta " href="http://"><span class="members of the window.locationvertical-align:/a> | <a href="<!doctype html>media="screen" <option value="favicon.ico" />
-               <div class="characteristics" method="get" /body>
-</html>
-shortcut icon" document.write(padding-bottom:representativessubmit" value="align="center" throughout the science fiction
-  <div class="submit" class="one of the most valign="top"><was established);\r
-</script>\r
-return false;">).style.displaybecause of the document.cookie<form action="/}body{margin:0;Encyclopedia ofversion of the .createElement(name" content="</div>
-</div>
-
-administrative </body>
-</html>history of the "><input type="portion of the as part of the &nbsp;<a href="other countries">
-<div class="</span></span><In other words,display: block;control of the introduction of/>
-<meta name="as well as the in recent years\r
-       <div class="</div>
-       </div>
-inspired by thethe end of the compatible withbecame known as style="margin:.js"></script>< International there have beenGerman language style="color:#Communist Partyconsistent withborder="0" cell marginheight="the majority of" align="centerrelated to the many different Orthodox Churchsimilar to the />
-<link rel="swas one of the until his death})();
-</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling="no" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign="center">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style="width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>
-       <div class="consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method="post" was followed by&amp;mdash; thethe applicationjs"></script>\r
-ul></div></div>after the deathwith respect tostyle="padding:is particularlydisplay:inline; type="submit" is divided into中文 (简体)responsabilidadadministracióninternacionalescorrespondienteउपयोगपूर्वहमारेलोगोंचुनावलेकिनसरकारपुलिसखोजेंचाहिएभेजेंशामिलहमारीजागरणबनानेकुमारब्लॉगमालिकमहिलापृष्ठबढ़तेभाजपाक्लिकट्रेनखिलाफदौरानमामलेमतदानबाजारविकासक्योंचाहतेपहुँचबतायासंवाददेखनेपिछलेविशेषराज्यउत्तरमुंबईदोनोंउपकरणपढ़ेंस्थितफिल्ममुख्यअच्छाछूटतीसंगीतजाएगाविभागघण्टेदूसरेदिनोंहत्यासेक्सगांधीविश्वरातेंदैट्सनक्शासामनेअदालतबिजलीपुरूषहिंदीमित्रकवितारुपयेस्थानकरोड़मुक्तयोजनाकृपयापोस्टघरेलूकार्यविचारसूचनामूल्यदेखेंहमेशास्कूलमैंनेतैयारजिसकेrss+xml" title="-type" content="title" content="at the same time.js"></script>
-<" method="post" </span></a></li>vertical-align:t/jquery.min.js">.click(function( style="padding-})();
-</script>
-</span><a href="<a href="http://); return false;text-decoration: scrolling="no" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif" border="0"</body>
-</html>
-overflow:hidden;img src="http://addEventListenerresponsible for s.js"></script>
-/favicon.ico" />operating system" style="width:1target="_blank">State Universitytext-align:left;
-document.write(, including the around the world);\r
-</script>\r
-<" style="height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>
-               </div>
-display: none;">" />
-<link rel="
-  (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the  align="center">University Pressdominated by theSecond World Wardistribution of style="position:the rest of the characterized by rel="nofollow">derives from therather than the a combination ofstyle="width:100English-speakingcomputer scienceborder="0" alt="the existence ofDemocratic Party" style="margin-For this reason,.js"></script>
-       sByTagName(s)[0]js"></script>\r
-<.js"></script>\r
-link rel="icon" ' alt='' class='formation of theversions of the </a></div></div>/page>
-  <page>
-<div class="contbecame the firstbahasa Indonesiaenglish (simple)ΕλληνικάхрватскикомпанииявляетсяДобавитьчеловекаразвитияИнтернетОтветитьнапримеринтернеткоторогостраницыкачествеусловияхпроблемыполучитьявляютсянаиболеекомпаниявниманиесредстваالمواضيعالرئيسيةالانتقالمشاركاتكالسياراتالمكتوبةالسعوديةاحصائياتالعالميةالصوتياتالانترنتالتصاميمالإسلاميالمشاركةالمرئياتrobots" content="<div id="footer">the United States<img src="http://.jpg|right|thumb|.js"></script>\r
-<location.protocolframeborder="0" s" />
-<meta name="</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:" rel="nofollow" President of the twentieth centuryevision>
-  </pageInternet Explorera.async = true;\r
-information about<div id="header">" action="http://<a href="https://<div id="content"</div>\r
-</div>\r
-<derived from the <img src='http://according to the 
-</body>
-</html>
-style="font-size:script language="Arial, Helvetica,</a><span class="</script><script political partiestd></tr></table><href="http://www.interpretation ofrel="stylesheet" document.write('<charset="utf-8">
-beginning of the revealed that thetelevision series" rel="nofollow"> target="_blank">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass="clearfix">/div>\r
-</div>\r
-\r
-three-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class="in some countriesmin.js"></script>of the populationofficial language<img src="images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>\r
-</html>\rΕλληνικά
-take advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class="headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype="text/css">
-the InternationalAccording to the pe="text/css" />
-coincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;" target="_blank" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type="application/anguage" content="<meta http-equiv="Privacy Policy</a>e("%3Cscript src='" target="_blank">On the other hand,.jpg|thumb|right|2</div><div class="<div style="float:nineteenth century</body>\r
-</html>\r
-<img src="http://s;text-align:centerfont-weight: bold; According to the difference between" frameborder="0" " style="position:link href="http://html4/loose.dtd">
-during this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type="text" <span style="font-onreadystatechange       <div class="cleardocument.location. For example, the a wide variety of <!DOCTYPE html>\r
-<&nbsp;&nbsp;&nbsp;"><a href="http://style="float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype="text/css" />it is possible to Harvard Universitytylesheet" href="/the main characterOxford University  name="keywords" cstyle="text-align:the United Kingdomfederal government<div style="margin depending on the description of the<div class="header.min.js"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc="http://staticsuggested that the" src="http://www.a large number of Telecommunications" rel="nofollow" tHoly Roman Emperoralmost exclusively" border="0" alt="Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle="background-<li><em><a href="/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src="http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref="https://www.recent developmentBoard of Directors<div class="search| <a href="http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>\r
-</div>\r
-\r
-<a href="index.phpwas established inmin.js"></script>
-participate in thea strong influencestyle="margin-top:represented by thegraduated from theTraditionally, theElement("script");However, since the/div>
-</div>
-<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype="image/x-icon/div>
-<div class=" class="clearfix"><div class="footer               </div>
-               </div>
-the motion pictureБългарскибългарскиФедерациинесколькосообщениесообщенияпрограммыОтправитьбесплатноматериалыпозволяетпоследниеразличныхпродукциипрограммаполностьюнаходитсяизбранноенаселенияизменениякатегорииАлександрद्वारामैनुअलप्रदानभारतीयअनुदेशहिन्दीइंडियादिल्लीअधिकारवीडियोचिट्ठेसमाचारजंक्शनदुनियाप्रयोगअनुसारऑनलाइनपार्टीशर्तोंलोकसभाफ़्लैशशर्तेंप्रदेशप्लेयरकेंद्रस्थितिउत्पादउन्हेंचिट्ठायात्राज्यादापुरानेजोड़ेंअनुवादश्रेणीशिक्षासरकारीसंग्रहपरिणामब्रांडबच्चोंउपलब्धमंत्रीसंपर्कउम्मीदमाध्यमसहायताशब्दोंमीडियाआईपीएलमोबाइलसंख्याआपरेशनअनुबंधबाज़ारनवीनतमप्रमुखप्रश्नपरिवारनुकसानसमर्थनआयोजितसोमवारالمشاركاتالمنتدياتالكمبيوترالمشاهداتعددالزوارعددالردودالإسلاميةالفوتوشوبالمسابقاتالمعلوماتالمسلسلاتالجرافيكسالاسلاميةالاتصالاتkeywords" content="w3.org/1999/xhtml"><a target="_blank" text/html; charset=" target="_blank"><table cellpadding="autocomplete="off" text-align: center;to last version by background-color: #" href="http://www./div></div><div id=<a href="#" class=""><img src="http://cript" src="http://
-<script language="//EN" "http://www.wencodeURIComponent(" href="javascript:<div class="contentdocument.write('<scposition: absolute;script src="http:// style="margin-top:.min.js"></script>
-</div>
-<div class="w3.org/1999/xhtml" 
-\r
-</body>\r
-</html>distinction between/" target="_blank"><link href="http://encoding="utf-8"?>
-w.addEventListener?action="http://www.icon" href="http:// style="background:type="text/css" />
-meta property="og:t<input type="text"  style="text-align:the development of tylesheet" type="tehtml; charset=utf-8is considered to betable width="100%" In addition to the contributed to the differences betweendevelopment of the It is important to </script>
-
-<script  style="font-size:1></span><span id=gbLibrary of Congress<img src="http://imEnglish translationAcademy of Sciencesdiv style="display:construction of the.getElementById(id)in conjunction withElement('script'); <meta property="og:Български
- type="text" name=">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src="http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style="background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet" href="/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland
-</script>
-<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv="X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0" cellpadding="0" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E"));<a href="http://www.<li><a href="http://site_name" content="text-decoration:nonestyle="display: none<meta http-equiv="X-new Date().getTime() type="image/x-icon"</span><span class="language="javascriptwindow.location.href<a href="javascript:-->\r
-<script type="t<a href='http://www.hortcut icon" href="</div>\r
-<div class="<script src="http://" rel="stylesheet" t</div>
-<script type=/a> <a href="http:// allowTransparency="X-UA-Compatible" conrelationship between
-</script>\r
-<script </a></li></ul></div>associated with the programming language</a><a href="http://</a></li><li class="form action="http://<div style="display:type="text" name="q"<table width="100%" background-position:" border="0" width="rel="shortcut icon" h6><ul><li><a href="  <meta http-equiv="css" media="screen" responsible for the " type="application/" style="background-html; charset=utf-8" allowtransparency="stylesheet" type="te\r
-<meta http-equiv="></span><span class="0" cellspacing="0">;
-</script>
-<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type="hidden" name="javascript:void(0);"effectiveness of the autocomplete="off" generally considered><input type="text" "></script>\r
-<scriptthroughout the worldcommon misconceptionassociation with the</div>
-</div>
-<div cduring his lifetime,corresponding to thetype="image/x-icon" an increasing numberdiplomatic relationsare often consideredmeta charset="utf-8" <input type="text" examples include the"><img src="http://iparticipation in thethe establishment of
-</div>
-<div class="&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset="utf-8"> type="text/css" />
-interchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type="text/csstype="submit" name="families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguês (Europeu)УкраїнськаукраїнськаРоссийскойматериаловинформацииуправлениянеобходимоинформацияИнформацияРеспубликиколичествоинформациютерриториидостаточноالمتواجدونالاشتراكاتالاقتراحاتhtml; charset=UTF-8" setTimeout(function()display:inline-block;<input type="submit" type = 'text/javascri<img src="http://www." "http://www.w3.org/shortcut icon" href="" autocomplete="off" </a></div><div class=</a></li>
-<li class="css" type="text/css" <form action="http://xt/css" href="http://link rel="alternate" \r
-<script type="text/ onclick="javascript:(new Date).getTime()}height="1" width="1" People's Republic of  <a href="http://www.text-decoration:underthe beginning of the </div>
-</div>
-</div>
-establishment of the </div></div></div></d#viewport{min-height:
-<script src="http://option><option value=often referred to as /option>
-<option valu<!DOCTYPE html>
-<!--[International Airport>
-<a href="http://www</a><a href="http://wภาษาไทยქართული正體中文 (繁體)निर्देशडाउनलोडक्षेत्रजानकारीसंबंधितस्थापनास्वीकारसंस्करणसामग्रीचिट्ठोंविज्ञानअमेरिकाविभिन्नगाडियाँक्योंकिसुरक्षापहुँचतीप्रबंधनटिप्पणीक्रिकेटप्रारंभप्राप्तमालिकोंरफ़्तारनिर्माणलिमिटेडdescription" content="document.location.prot.getElementsByTagName(<!DOCTYPE html>
-<html <meta charset="utf-8">:url" content="http://.css" rel="stylesheet"style type="text/css">type="text/css" href="w3.org/1999/xhtml" xmltype="text/javascript" method="get" action="link rel="stylesheet"  = document.getElementtype="image/x-icon" />cellpadding="0" cellsp.css" type="text/css" </a></li><li><a href="" width="1" height="1""><a href="http://www.style="display:none;">alternate" type="appli-//W3C//DTD XHTML 1.0 ellspacing="0" cellpad type="hidden" value="/a>&nbsp;<span role="s
-<input type="hidden" language="JavaScript"  document.getElementsBg="0" cellspacing="0" ype="text/css" media="type='text/javascript'with the exception of ype="text/css" rel="st height="1" width="1" ='+encodeURIComponent(<link rel="alternate" 
-body, tr, input, textmeta name="robots" conmethod="post" action=">
-<a href="http://www.css" rel="stylesheet" </div></div><div classlanguage="javascript">aria-hidden="true">·<ript" type="text/javasl=0;})();
-(function(){background-image: url(/a></li><li><a href="h               <li><a href="http://ator" aria-hidden="tru> <a href="http://www.language="javascript" /option>
-<option value/div></div><div class=rator" aria-hidden="tre=(new Date).getTime()português (do Brasil)организациивозможностьобразованиярегистрациивозможностиобязательна<!DOCTYPE html PUBLIC "nt-Type" content="text/<meta http-equiv="Conteransitional//EN" "http:<html xmlns="http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = 'text/javascript';<meta name="descriptionparentNode.insertBefore<input type="hidden" najs" type="text/javascri(document).ready(functiscript type="text/javasimage" content="http://UA-Compatible" content=tml; charset=utf-8" />
-link rel="shortcut icon<link rel="stylesheet" </script>
-<script type== document.createElemen<a target="_blank" href= document.getElementsBinput type="text" name=a.type = 'text/javascrinput type="hidden" namehtml; charset=utf-8" />dtd">
-<html xmlns="http-//W3C//DTD HTML 4.01 TentsByTagName('script')input type="hidden" nam<script type="text/javas" style="display:none;">document.getElementById(=document.createElement(' type='text/javascript'input type="text" name="d.getElementsByTagName(snical" href="http://www.C//DTD HTML 4.01 Transit<style type="text/css">
-
-<style type="text/css">ional.dtd">
-<html xmlns=http-equiv="Content-Typeding="0" cellspacing="0"html; charset=utf-8" />
- style="display:none;"><<li><a href="http://www. type='text/javascript'>деятельностисоответствиипроизводствабезопасностиपुस्तिकाकांग्रेसउन्होंनेविधानसभाफिक्सिंगसुरक्षितकॉपीराइटविज्ञापनकार्रवाईसक्रियता
\ No newline at end of file
diff --git a/Source/ThirdParty/brotli/common/dictionary.c b/Source/ThirdParty/brotli/common/dictionary.c
deleted file mode 100644 (file)
index d0872bd..0000000
+++ /dev/null
@@ -1,5905 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-#include "./dictionary.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-#ifndef BROTLI_EXTERNAL_DICTIONARY_DATA
-static const uint8_t kBrotliDictionaryData[] =
-{
-116,105,109,101,100,111,119,110,108,105,102,101,108,101,102,116,98,97,99,107,99,
-111,100,101,100,97,116,97,115,104,111,119,111,110,108,121,115,105,116,101,99,105
-,116,121,111,112,101,110,106,117,115,116,108,105,107,101,102,114,101,101,119,111
-,114,107,116,101,120,116,121,101,97,114,111,118,101,114,98,111,100,121,108,111,
-118,101,102,111,114,109,98,111,111,107,112,108,97,121,108,105,118,101,108,105,
-110,101,104,101,108,112,104,111,109,101,115,105,100,101,109,111,114,101,119,111,
-114,100,108,111,110,103,116,104,101,109,118,105,101,119,102,105,110,100,112,97,
-103,101,100,97,121,115,102,117,108,108,104,101,97,100,116,101,114,109,101,97,99,
-104,97,114,101,97,102,114,111,109,116,114,117,101,109,97,114,107,97,98,108,101,
-117,112,111,110,104,105,103,104,100,97,116,101,108,97,110,100,110,101,119,115,
-101,118,101,110,110,101,120,116,99,97,115,101,98,111,116,104,112,111,115,116,117
-,115,101,100,109,97,100,101,104,97,110,100,104,101,114,101,119,104,97,116,110,97
-,109,101,76,105,110,107,98,108,111,103,115,105,122,101,98,97,115,101,104,101,108
-,100,109,97,107,101,109,97,105,110,117,115,101,114,39,41,32,43,104,111,108,100,
-101,110,100,115,119,105,116,104,78,101,119,115,114,101,97,100,119,101,114,101,
-115,105,103,110,116,97,107,101,104,97,118,101,103,97,109,101,115,101,101,110,99,
-97,108,108,112,97,116,104,119,101,108,108,112,108,117,115,109,101,110,117,102,
-105,108,109,112,97,114,116,106,111,105,110,116,104,105,115,108,105,115,116,103,
-111,111,100,110,101,101,100,119,97,121,115,119,101,115,116,106,111,98,115,109,
-105,110,100,97,108,115,111,108,111,103,111,114,105,99,104,117,115,101,115,108,97
-,115,116,116,101,97,109,97,114,109,121,102,111,111,100,107,105,110,103,119,105,
-108,108,101,97,115,116,119,97,114,100,98,101,115,116,102,105,114,101,80,97,103,
-101,107,110,111,119,97,119,97,121,46,112,110,103,109,111,118,101,116,104,97,110,
-108,111,97,100,103,105,118,101,115,101,108,102,110,111,116,101,109,117,99,104,
-102,101,101,100,109,97,110,121,114,111,99,107,105,99,111,110,111,110,99,101,108,
-111,111,107,104,105,100,101,100,105,101,100,72,111,109,101,114,117,108,101,104,
-111,115,116,97,106,97,120,105,110,102,111,99,108,117,98,108,97,119,115,108,101,
-115,115,104,97,108,102,115,111,109,101,115,117,99,104,122,111,110,101,49,48,48,
-37,111,110,101,115,99,97,114,101,84,105,109,101,114,97,99,101,98,108,117,101,102
-,111,117,114,119,101,101,107,102,97,99,101,104,111,112,101,103,97,118,101,104,97
-,114,100,108,111,115,116,119,104,101,110,112,97,114,107,107,101,112,116,112,97,
-115,115,115,104,105,112,114,111,111,109,72,84,77,76,112,108,97,110,84,121,112,
-101,100,111,110,101,115,97,118,101,107,101,101,112,102,108,97,103,108,105,110,
-107,115,111,108,100,102,105,118,101,116,111,111,107,114,97,116,101,116,111,119,
-110,106,117,109,112,116,104,117,115,100,97,114,107,99,97,114,100,102,105,108,101
-,102,101,97,114,115,116,97,121,107,105,108,108,116,104,97,116,102,97,108,108,97,
-117,116,111,101,118,101,114,46,99,111,109,116,97,108,107,115,104,111,112,118,111
-,116,101,100,101,101,112,109,111,100,101,114,101,115,116,116,117,114,110,98,111,
-114,110,98,97,110,100,102,101,108,108,114,111,115,101,117,114,108,40,115,107,105
-,110,114,111,108,101,99,111,109,101,97,99,116,115,97,103,101,115,109,101,101,116
-,103,111,108,100,46,106,112,103,105,116,101,109,118,97,114,121,102,101,108,116,
-116,104,101,110,115,101,110,100,100,114,111,112,86,105,101,119,99,111,112,121,49
-,46,48,34,60,47,97,62,115,116,111,112,101,108,115,101,108,105,101,115,116,111,
-117,114,112,97,99,107,46,103,105,102,112,97,115,116,99,115,115,63,103,114,97,121
-,109,101,97,110,38,103,116,59,114,105,100,101,115,104,111,116,108,97,116,101,115
-,97,105,100,114,111,97,100,118,97,114,32,102,101,101,108,106,111,104,110,114,105
-,99,107,112,111,114,116,102,97,115,116,39,85,65,45,100,101,97,100,60,47,98,62,
-112,111,111,114,98,105,108,108,116,121,112,101,85,46,83,46,119,111,111,100,109,
-117,115,116,50,112,120,59,73,110,102,111,114,97,110,107,119,105,100,101,119,97,
-110,116,119,97,108,108,108,101,97,100,91,48,93,59,112,97,117,108,119,97,118,101,
-115,117,114,101,36,40,39,35,119,97,105,116,109,97,115,115,97,114,109,115,103,111
-,101,115,103,97,105,110,108,97,110,103,112,97,105,100,33,45,45,32,108,111,99,107
-,117,110,105,116,114,111,111,116,119,97,108,107,102,105,114,109,119,105,102,101,
-120,109,108,34,115,111,110,103,116,101,115,116,50,48,112,120,107,105,110,100,114
-,111,119,115,116,111,111,108,102,111,110,116,109,97,105,108,115,97,102,101,115,
-116,97,114,109,97,112,115,99,111,114,101,114,97,105,110,102,108,111,119,98,97,98
-,121,115,112,97,110,115,97,121,115,52,112,120,59,54,112,120,59,97,114,116,115,
-102,111,111,116,114,101,97,108,119,105,107,105,104,101,97,116,115,116,101,112,
-116,114,105,112,111,114,103,47,108,97,107,101,119,101,97,107,116,111,108,100,70,
-111,114,109,99,97,115,116,102,97,110,115,98,97,110,107,118,101,114,121,114,117,
-110,115,106,117,108,121,116,97,115,107,49,112,120,59,103,111,97,108,103,114,101,
-119,115,108,111,119,101,100,103,101,105,100,61,34,115,101,116,115,53,112,120,59,
-46,106,115,63,52,48,112,120,105,102,32,40,115,111,111,110,115,101,97,116,110,111
-,110,101,116,117,98,101,122,101,114,111,115,101,110,116,114,101,101,100,102,97,
-99,116,105,110,116,111,103,105,102,116,104,97,114,109,49,56,112,120,99,97,109,
-101,104,105,108,108,98,111,108,100,122,111,111,109,118,111,105,100,101,97,115,
-121,114,105,110,103,102,105,108,108,112,101,97,107,105,110,105,116,99,111,115,
-116,51,112,120,59,106,97,99,107,116,97,103,115,98,105,116,115,114,111,108,108,
-101,100,105,116,107,110,101,119,110,101,97,114,60,33,45,45,103,114,111,119,74,83
-,79,78,100,117,116,121,78,97,109,101,115,97,108,101,121,111,117,32,108,111,116,
-115,112,97,105,110,106,97,122,122,99,111,108,100,101,121,101,115,102,105,115,104
-,119,119,119,46,114,105,115,107,116,97,98,115,112,114,101,118,49,48,112,120,114,
-105,115,101,50,53,112,120,66,108,117,101,100,105,110,103,51,48,48,44,98,97,108,
-108,102,111,114,100,101,97,114,110,119,105,108,100,98,111,120,46,102,97,105,114,
-108,97,99,107,118,101,114,115,112,97,105,114,106,117,110,101,116,101,99,104,105,
-102,40,33,112,105,99,107,101,118,105,108,36,40,34,35,119,97,114,109,108,111,114,
-100,100,111,101,115,112,117,108,108,44,48,48,48,105,100,101,97,100,114,97,119,
-104,117,103,101,115,112,111,116,102,117,110,100,98,117,114,110,104,114,101,102,
-99,101,108,108,107,101,121,115,116,105,99,107,104,111,117,114,108,111,115,115,
-102,117,101,108,49,50,112,120,115,117,105,116,100,101,97,108,82,83,83,34,97,103,
-101,100,103,114,101,121,71,69,84,34,101,97,115,101,97,105,109,115,103,105,114,
-108,97,105,100,115,56,112,120,59,110,97,118,121,103,114,105,100,116,105,112,115,
-35,57,57,57,119,97,114,115,108,97,100,121,99,97,114,115,41,59,32,125,112,104,112
-,63,104,101,108,108,116,97,108,108,119,104,111,109,122,104,58,229,42,47,13,10,32
-,49,48,48,104,97,108,108,46,10,10,65,55,112,120,59,112,117,115,104,99,104,97,116
-,48,112,120,59,99,114,101,119,42,47,60,47,104,97,115,104,55,53,112,120,102,108,
-97,116,114,97,114,101,32,38,38,32,116,101,108,108,99,97,109,112,111,110,116,111,
-108,97,105,100,109,105,115,115,115,107,105,112,116,101,110,116,102,105,110,101,
-109,97,108,101,103,101,116,115,112,108,111,116,52,48,48,44,13,10,13,10,99,111,
-111,108,102,101,101,116,46,112,104,112,60,98,114,62,101,114,105,99,109,111,115,
-116,103,117,105,100,98,101,108,108,100,101,115,99,104,97,105,114,109,97,116,104,
-97,116,111,109,47,105,109,103,38,35,56,50,108,117,99,107,99,101,110,116,48,48,48
-,59,116,105,110,121,103,111,110,101,104,116,109,108,115,101,108,108,100,114,117,
-103,70,82,69,69,110,111,100,101,110,105,99,107,63,105,100,61,108,111,115,101,110
-,117,108,108,118,97,115,116,119,105,110,100,82,83,83,32,119,101,97,114,114,101,
-108,121,98,101,101,110,115,97,109,101,100,117,107,101,110,97,115,97,99,97,112,
-101,119,105,115,104,103,117,108,102,84,50,51,58,104,105,116,115,115,108,111,116,
-103,97,116,101,107,105,99,107,98,108,117,114,116,104,101,121,49,53,112,120,39,39
-,41,59,41,59,34,62,109,115,105,101,119,105,110,115,98,105,114,100,115,111,114,
-116,98,101,116,97,115,101,101,107,84,49,56,58,111,114,100,115,116,114,101,101,
-109,97,108,108,54,48,112,120,102,97,114,109,226,128,153,115,98,111,121,115,91,48
-,93,46,39,41,59,34,80,79,83,84,98,101,97,114,107,105,100,115,41,59,125,125,109,
-97,114,121,116,101,110,100,40,85,75,41,113,117,97,100,122,104,58,230,45,115,105,
-122,45,45,45,45,112,114,111,112,39,41,59,13,108,105,102,116,84,49,57,58,118,105,
-99,101,97,110,100,121,100,101,98,116,62,82,83,83,112,111,111,108,110,101,99,107,
-98,108,111,119,84,49,54,58,100,111,111,114,101,118,97,108,84,49,55,58,108,101,
-116,115,102,97,105,108,111,114,97,108,112,111,108,108,110,111,118,97,99,111,108,
-115,103,101,110,101,32,226,128,148,115,111,102,116,114,111,109,101,116,105,108,
-108,114,111,115,115,60,104,51,62,112,111,117,114,102,97,100,101,112,105,110,107,
-60,116,114,62,109,105,110,105,41,124,33,40,109,105,110,101,122,104,58,232,98,97,
-114,115,104,101,97,114,48,48,41,59,109,105,108,107,32,45,45,62,105,114,111,110,
-102,114,101,100,100,105,115,107,119,101,110,116,115,111,105,108,112,117,116,115,
-47,106,115,47,104,111,108,121,84,50,50,58,73,83,66,78,84,50,48,58,97,100,97,109,
-115,101,101,115,60,104,50,62,106,115,111,110,39,44,32,39,99,111,110,116,84,50,49
-,58,32,82,83,83,108,111,111,112,97,115,105,97,109,111,111,110,60,47,112,62,115,
-111,117,108,76,73,78,69,102,111,114,116,99,97,114,116,84,49,52,58,60,104,49,62,
-56,48,112,120,33,45,45,60,57,112,120,59,84,48,52,58,109,105,107,101,58,52,54,90,
-110,105,99,101,105,110,99,104,89,111,114,107,114,105,99,101,122,104,58,228,39,41
-,41,59,112,117,114,101,109,97,103,101,112,97,114,97,116,111,110,101,98,111,110,
-100,58,51,55,90,95,111,102,95,39,93,41,59,48,48,48,44,122,104,58,231,116,97,110,
-107,121,97,114,100,98,111,119,108,98,117,115,104,58,53,54,90,74,97,118,97,51,48,
-112,120,10,124,125,10,37,67,51,37,58,51,52,90,106,101,102,102,69,88,80,73,99,97,
-115,104,118,105,115,97,103,111,108,102,115,110,111,119,122,104,58,233,113,117,
-101,114,46,99,115,115,115,105,99,107,109,101,97,116,109,105,110,46,98,105,110,
-100,100,101,108,108,104,105,114,101,112,105,99,115,114,101,110,116,58,51,54,90,
-72,84,84,80,45,50,48,49,102,111,116,111,119,111,108,102,69,78,68,32,120,98,111,
-120,58,53,52,90,66,79,68,89,100,105,99,107,59,10,125,10,101,120,105,116,58,51,53
-,90,118,97,114,115,98,101,97,116,39,125,41,59,100,105,101,116,57,57,57,59,97,110
-,110,101,125,125,60,47,91,105,93,46,76,97,110,103,107,109,194,178,119,105,114,
-101,116,111,121,115,97,100,100,115,115,101,97,108,97,108,101,120,59,10,9,125,101
-,99,104,111,110,105,110,101,46,111,114,103,48,48,53,41,116,111,110,121,106,101,
-119,115,115,97,110,100,108,101,103,115,114,111,111,102,48,48,48,41,32,50,48,48,
-119,105,110,101,103,101,97,114,100,111,103,115,98,111,111,116,103,97,114,121,99,
-117,116,115,116,121,108,101,116,101,109,112,116,105,111,110,46,120,109,108,99,
-111,99,107,103,97,110,103,36,40,39,46,53,48,112,120,80,104,46,68,109,105,115,99,
-97,108,97,110,108,111,97,110,100,101,115,107,109,105,108,101,114,121,97,110,117,
-110,105,120,100,105,115,99,41,59,125,10,100,117,115,116,99,108,105,112,41,46,10,
-10,55,48,112,120,45,50,48,48,68,86,68,115,55,93,62,60,116,97,112,101,100,101,109
-,111,105,43,43,41,119,97,103,101,101,117,114,111,112,104,105,108,111,112,116,115
-,104,111,108,101,70,65,81,115,97,115,105,110,45,50,54,84,108,97,98,115,112,101,
-116,115,85,82,76,32,98,117,108,107,99,111,111,107,59,125,13,10,72,69,65,68,91,48
-,93,41,97,98,98,114,106,117,97,110,40,49,57,56,108,101,115,104,116,119,105,110,
-60,47,105,62,115,111,110,121,103,117,121,115,102,117,99,107,112,105,112,101,124,
-45,10,33,48,48,50,41,110,100,111,119,91,49,93,59,91,93,59,10,76,111,103,32,115,
-97,108,116,13,10,9,9,98,97,110,103,116,114,105,109,98,97,116,104,41,123,13,10,48
-,48,112,120,10,125,41,59,107,111,58,236,102,101,101,115,97,100,62,13,115,58,47,
-47,32,91,93,59,116,111,108,108,112,108,117,103,40,41,123,10,123,13,10,32,46,106,
-115,39,50,48,48,112,100,117,97,108,98,111,97,116,46,74,80,71,41,59,10,125,113,
-117,111,116,41,59,10,10,39,41,59,10,13,10,125,13,50,48,49,52,50,48,49,53,50,48,
-49,54,50,48,49,55,50,48,49,56,50,48,49,57,50,48,50,48,50,48,50,49,50,48,50,50,50
-,48,50,51,50,48,50,52,50,48,50,53,50,48,50,54,50,48,50,55,50,48,50,56,50,48,50,
-57,50,48,51,48,50,48,51,49,50,48,51,50,50,48,51,51,50,48,51,52,50,48,51,53,50,48
-,51,54,50,48,51,55,50,48,49,51,50,48,49,50,50,48,49,49,50,48,49,48,50,48,48,57,
-50,48,48,56,50,48,48,55,50,48,48,54,50,48,48,53,50,48,48,52,50,48,48,51,50,48,48
-,50,50,48,48,49,50,48,48,48,49,57,57,57,49,57,57,56,49,57,57,55,49,57,57,54,49,
-57,57,53,49,57,57,52,49,57,57,51,49,57,57,50,49,57,57,49,49,57,57,48,49,57,56,57
-,49,57,56,56,49,57,56,55,49,57,56,54,49,57,56,53,49,57,56,52,49,57,56,51,49,57,
-56,50,49,57,56,49,49,57,56,48,49,57,55,57,49,57,55,56,49,57,55,55,49,57,55,54,49
-,57,55,53,49,57,55,52,49,57,55,51,49,57,55,50,49,57,55,49,49,57,55,48,49,57,54,
-57,49,57,54,56,49,57,54,55,49,57,54,54,49,57,54,53,49,57,54,52,49,57,54,51,49,57
-,54,50,49,57,54,49,49,57,54,48,49,57,53,57,49,57,53,56,49,57,53,55,49,57,53,54,
-49,57,53,53,49,57,53,52,49,57,53,51,49,57,53,50,49,57,53,49,49,57,53,48,49,48,48
-,48,49,48,50,52,49,51,57,52,48,48,48,48,57,57,57,57,99,111,109,111,109,195,161,
-115,101,115,116,101,101,115,116,97,112,101,114,111,116,111,100,111,104,97,99,101
-,99,97,100,97,97,195,177,111,98,105,101,110,100,195,173,97,97,115,195,173,118,
-105,100,97,99,97,115,111,111,116,114,111,102,111,114,111,115,111,108,111,111,116
-,114,97,99,117,97,108,100,105,106,111,115,105,100,111,103,114,97,110,116,105,112
-,111,116,101,109,97,100,101,98,101,97,108,103,111,113,117,195,169,101,115,116,
-111,110,97,100,97,116,114,101,115,112,111,99,111,99,97,115,97,98,97,106,111,116,
-111,100,97,115,105,110,111,97,103,117,97,112,117,101,115,117,110,111,115,97,110,
-116,101,100,105,99,101,108,117,105,115,101,108,108,97,109,97,121,111,122,111,110
-,97,97,109,111,114,112,105,115,111,111,98,114,97,99,108,105,99,101,108,108,111,
-100,105,111,115,104,111,114,97,99,97,115,105,208,183,208,176,208,189,208,176,208
-,190,208,188,209,128,208,176,209,128,209,131,209,130,208,176,208,189,208,181,208
-,191,208,190,208,190,209,130,208,184,208,183,208,189,208,190,208,180,208,190,209
-,130,208,190,208,182,208,181,208,190,208,189,208,184,209,133,208,157,208,176,208
-,181,208,181,208,177,209,139,208,188,209,139,208,146,209,139,209,129,208,190,208
-,178,209,139,208,178,208,190,208,157,208,190,208,190,208,177,208,159,208,190,208
-,187,208,184,208,189,208,184,208,160,208,164,208,157,208,181,208,156,209,139,209
-,130,209,139,208,158,208,189,208,184,208,188,208,180,208,176,208,151,208,176,208
-,148,208,176,208,157,209,131,208,158,208,177,209,130,208,181,208,152,208,183,208
-,181,208,185,208,189,209,131,208,188,208,188,208,162,209,139,209,131,208,182,217
-,129,217,138,216,163,217,134,217,133,216,167,217,133,216,185,217,131,217,132,216
-,163,217,136,216,177,216,175,217,138,216,167,217,129,217,137,217,135,217,136,217
-,132,217,133,217,132,217,131,216,167,217,136,217,132,217,135,216,168,216,179,216
-,167,217,132,216,165,217,134,217,135,217,138,216,163,217,138,217,130,216,175,217
-,135,217,132,216,171,217,133,216,168,217,135,217,132,217,136,217,132,217,138,216
-,168,217,132,216,167,217,138,216,168,217,131,216,180,217,138,216,167,217,133,216
-,163,217,133,217,134,216,170,216,168,217,138,217,132,217,134,216,173,216,168,217
-,135,217,133,217,133,216,180,217,136,216,180,102,105,114,115,116,118,105,100,101
-,111,108,105,103,104,116,119,111,114,108,100,109,101,100,105,97,119,104,105,116,
-101,99,108,111,115,101,98,108,97,99,107,114,105,103,104,116,115,109,97,108,108,
-98,111,111,107,115,112,108,97,99,101,109,117,115,105,99,102,105,101,108,100,111,
-114,100,101,114,112,111,105,110,116,118,97,108,117,101,108,101,118,101,108,116,
-97,98,108,101,98,111,97,114,100,104,111,117,115,101,103,114,111,117,112,119,111,
-114,107,115,121,101,97,114,115,115,116,97,116,101,116,111,100,97,121,119,97,116,
-101,114,115,116,97,114,116,115,116,121,108,101,100,101,97,116,104,112,111,119,
-101,114,112,104,111,110,101,110,105,103,104,116,101,114,114,111,114,105,110,112,
-117,116,97,98,111,117,116,116,101,114,109,115,116,105,116,108,101,116,111,111,
-108,115,101,118,101,110,116,108,111,99,97,108,116,105,109,101,115,108,97,114,103
-,101,119,111,114,100,115,103,97,109,101,115,115,104,111,114,116,115,112,97,99,
-101,102,111,99,117,115,99,108,101,97,114,109,111,100,101,108,98,108,111,99,107,
-103,117,105,100,101,114,97,100,105,111,115,104,97,114,101,119,111,109,101,110,97
-,103,97,105,110,109,111,110,101,121,105,109,97,103,101,110,97,109,101,115,121,
-111,117,110,103,108,105,110,101,115,108,97,116,101,114,99,111,108,111,114,103,
-114,101,101,110,102,114,111,110,116,38,97,109,112,59,119,97,116,99,104,102,111,
-114,99,101,112,114,105,99,101,114,117,108,101,115,98,101,103,105,110,97,102,116,
-101,114,118,105,115,105,116,105,115,115,117,101,97,114,101,97,115,98,101,108,111
-,119,105,110,100,101,120,116,111,116,97,108,104,111,117,114,115,108,97,98,101,
-108,112,114,105,110,116,112,114,101,115,115,98,117,105,108,116,108,105,110,107,
-115,115,112,101,101,100,115,116,117,100,121,116,114,97,100,101,102,111,117,110,
-100,115,101,110,115,101,117,110,100,101,114,115,104,111,119,110,102,111,114,109,
-115,114,97,110,103,101,97,100,100,101,100,115,116,105,108,108,109,111,118,101,
-100,116,97,107,101,110,97,98,111,118,101,102,108,97,115,104,102,105,120,101,100,
-111,102,116,101,110,111,116,104,101,114,118,105,101,119,115,99,104,101,99,107,
-108,101,103,97,108,114,105,118,101,114,105,116,101,109,115,113,117,105,99,107,
-115,104,97,112,101,104,117,109,97,110,101,120,105,115,116,103,111,105,110,103,
-109,111,118,105,101,116,104,105,114,100,98,97,115,105,99,112,101,97,99,101,115,
-116,97,103,101,119,105,100,116,104,108,111,103,105,110,105,100,101,97,115,119,
-114,111,116,101,112,97,103,101,115,117,115,101,114,115,100,114,105,118,101,115,
-116,111,114,101,98,114,101,97,107,115,111,117,116,104,118,111,105,99,101,115,105
-,116,101,115,109,111,110,116,104,119,104,101,114,101,98,117,105,108,100,119,104,
-105,99,104,101,97,114,116,104,102,111,114,117,109,116,104,114,101,101,115,112,
-111,114,116,112,97,114,116,121,67,108,105,99,107,108,111,119,101,114,108,105,118
-,101,115,99,108,97,115,115,108,97,121,101,114,101,110,116,114,121,115,116,111,
-114,121,117,115,97,103,101,115,111,117,110,100,99,111,117,114,116,121,111,117,
-114,32,98,105,114,116,104,112,111,112,117,112,116,121,112,101,115,97,112,112,108
-,121,73,109,97,103,101,98,101,105,110,103,117,112,112,101,114,110,111,116,101,
-115,101,118,101,114,121,115,104,111,119,115,109,101,97,110,115,101,120,116,114,
-97,109,97,116,99,104,116,114,97,99,107,107,110,111,119,110,101,97,114,108,121,98
-,101,103,97,110,115,117,112,101,114,112,97,112,101,114,110,111,114,116,104,108,
-101,97,114,110,103,105,118,101,110,110,97,109,101,100,101,110,100,101,100,84,101
-,114,109,115,112,97,114,116,115,71,114,111,117,112,98,114,97,110,100,117,115,105
-,110,103,119,111,109,97,110,102,97,108,115,101,114,101,97,100,121,97,117,100,105
-,111,116,97,107,101,115,119,104,105,108,101,46,99,111,109,47,108,105,118,101,100
-,99,97,115,101,115,100,97,105,108,121,99,104,105,108,100,103,114,101,97,116,106,
-117,100,103,101,116,104,111,115,101,117,110,105,116,115,110,101,118,101,114,98,
-114,111,97,100,99,111,97,115,116,99,111,118,101,114,97,112,112,108,101,102,105,
-108,101,115,99,121,99,108,101,115,99,101,110,101,112,108,97,110,115,99,108,105,
-99,107,119,114,105,116,101,113,117,101,101,110,112,105,101,99,101,101,109,97,105
-,108,102,114,97,109,101,111,108,100,101,114,112,104,111,116,111,108,105,109,105,
-116,99,97,99,104,101,99,105,118,105,108,115,99,97,108,101,101,110,116,101,114,
-116,104,101,109,101,116,104,101,114,101,116,111,117,99,104,98,111,117,110,100,
-114,111,121,97,108,97,115,107,101,100,119,104,111,108,101,115,105,110,99,101,115
-,116,111,99,107,32,110,97,109,101,102,97,105,116,104,104,101,97,114,116,101,109,
-112,116,121,111,102,102,101,114,115,99,111,112,101,111,119,110,101,100,109,105,
-103,104,116,97,108,98,117,109,116,104,105,110,107,98,108,111,111,100,97,114,114,
-97,121,109,97,106,111,114,116,114,117,115,116,99,97,110,111,110,117,110,105,111,
-110,99,111,117,110,116,118,97,108,105,100,115,116,111,110,101,83,116,121,108,101
-,76,111,103,105,110,104,97,112,112,121,111,99,99,117,114,108,101,102,116,58,102,
-114,101,115,104,113,117,105,116,101,102,105,108,109,115,103,114,97,100,101,110,
-101,101,100,115,117,114,98,97,110,102,105,103,104,116,98,97,115,105,115,104,111,
-118,101,114,97,117,116,111,59,114,111,117,116,101,46,104,116,109,108,109,105,120
-,101,100,102,105,110,97,108,89,111,117,114,32,115,108,105,100,101,116,111,112,
-105,99,98,114,111,119,110,97,108,111,110,101,100,114,97,119,110,115,112,108,105,
-116,114,101,97,99,104,82,105,103,104,116,100,97,116,101,115,109,97,114,99,104,
-113,117,111,116,101,103,111,111,100,115,76,105,110,107,115,100,111,117,98,116,97
-,115,121,110,99,116,104,117,109,98,97,108,108,111,119,99,104,105,101,102,121,111
-,117,116,104,110,111,118,101,108,49,48,112,120,59,115,101,114,118,101,117,110,
-116,105,108,104,97,110,100,115,67,104,101,99,107,83,112,97,99,101,113,117,101,
-114,121,106,97,109,101,115,101,113,117,97,108,116,119,105,99,101,48,44,48,48,48,
-83,116,97,114,116,112,97,110,101,108,115,111,110,103,115,114,111,117,110,100,101
-,105,103,104,116,115,104,105,102,116,119,111,114,116,104,112,111,115,116,115,108
-,101,97,100,115,119,101,101,107,115,97,118,111,105,100,116,104,101,115,101,109,
-105,108,101,115,112,108,97,110,101,115,109,97,114,116,97,108,112,104,97,112,108,
-97,110,116,109,97,114,107,115,114,97,116,101,115,112,108,97,121,115,99,108,97,
-105,109,115,97,108,101,115,116,101,120,116,115,115,116,97,114,115,119,114,111,
-110,103,60,47,104,51,62,116,104,105,110,103,46,111,114,103,47,109,117,108,116,
-105,104,101,97,114,100,80,111,119,101,114,115,116,97,110,100,116,111,107,101,110
-,115,111,108,105,100,40,116,104,105,115,98,114,105,110,103,115,104,105,112,115,
-115,116,97,102,102,116,114,105,101,100,99,97,108,108,115,102,117,108,108,121,102
-,97,99,116,115,97,103,101,110,116,84,104,105,115,32,47,47,45,45,62,97,100,109,
-105,110,101,103,121,112,116,69,118,101,110,116,49,53,112,120,59,69,109,97,105,
-108,116,114,117,101,34,99,114,111,115,115,115,112,101,110,116,98,108,111,103,115
-,98,111,120,34,62,110,111,116,101,100,108,101,97,118,101,99,104,105,110,97,115,
-105,122,101,115,103,117,101,115,116,60,47,104,52,62,114,111,98,111,116,104,101,
-97,118,121,116,114,117,101,44,115,101,118,101,110,103,114,97,110,100,99,114,105,
-109,101,115,105,103,110,115,97,119,97,114,101,100,97,110,99,101,112,104,97,115,
-101,62,60,33,45,45,101,110,95,85,83,38,35,51,57,59,50,48,48,112,120,95,110,97,
-109,101,108,97,116,105,110,101,110,106,111,121,97,106,97,120,46,97,116,105,111,
-110,115,109,105,116,104,85,46,83,46,32,104,111,108,100,115,112,101,116,101,114,
-105,110,100,105,97,110,97,118,34,62,99,104,97,105,110,115,99,111,114,101,99,111,
-109,101,115,100,111,105,110,103,112,114,105,111,114,83,104,97,114,101,49,57,57,
-48,115,114,111,109,97,110,108,105,115,116,115,106,97,112,97,110,102,97,108,108,
-115,116,114,105,97,108,111,119,110,101,114,97,103,114,101,101,60,47,104,50,62,97
-,98,117,115,101,97,108,101,114,116,111,112,101,114,97,34,45,47,47,87,99,97,114,
-100,115,104,105,108,108,115,116,101,97,109,115,80,104,111,116,111,116,114,117,
-116,104,99,108,101,97,110,46,112,104,112,63,115,97,105,110,116,109,101,116,97,
-108,108,111,117,105,115,109,101,97,110,116,112,114,111,111,102,98,114,105,101,
-102,114,111,119,34,62,103,101,110,114,101,116,114,117,99,107,108,111,111,107,115
-,86,97,108,117,101,70,114,97,109,101,46,110,101,116,47,45,45,62,10,60,116,114,
-121,32,123,10,118,97,114,32,109,97,107,101,115,99,111,115,116,115,112,108,97,105
-,110,97,100,117,108,116,113,117,101,115,116,116,114,97,105,110,108,97,98,111,114
-,104,101,108,112,115,99,97,117,115,101,109,97,103,105,99,109,111,116,111,114,116
-,104,101,105,114,50,53,48,112,120,108,101,97,115,116,115,116,101,112,115,67,111,
-117,110,116,99,111,117,108,100,103,108,97,115,115,115,105,100,101,115,102,117,
-110,100,115,104,111,116,101,108,97,119,97,114,100,109,111,117,116,104,109,111,
-118,101,115,112,97,114,105,115,103,105,118,101,115,100,117,116,99,104,116,101,
-120,97,115,102,114,117,105,116,110,117,108,108,44,124,124,91,93,59,116,111,112,
-34,62,10,60,33,45,45,80,79,83,84,34,111,99,101,97,110,60,98,114,47,62,102,108,
-111,111,114,115,112,101,97,107,100,101,112,116,104,32,115,105,122,101,98,97,110,
-107,115,99,97,116,99,104,99,104,97,114,116,50,48,112,120,59,97,108,105,103,110,
-100,101,97,108,115,119,111,117,108,100,53,48,112,120,59,117,114,108,61,34,112,97
-,114,107,115,109,111,117,115,101,77,111,115,116,32,46,46,46,60,47,97,109,111,110
-,103,98,114,97,105,110,98,111,100,121,32,110,111,110,101,59,98,97,115,101,100,99
-,97,114,114,121,100,114,97,102,116,114,101,102,101,114,112,97,103,101,95,104,111
-,109,101,46,109,101,116,101,114,100,101,108,97,121,100,114,101,97,109,112,114,
-111,118,101,106,111,105,110,116,60,47,116,114,62,100,114,117,103,115,60,33,45,45
-,32,97,112,114,105,108,105,100,101,97,108,97,108,108,101,110,101,120,97,99,116,
-102,111,114,116,104,99,111,100,101,115,108,111,103,105,99,86,105,101,119,32,115,
-101,101,109,115,98,108,97,110,107,112,111,114,116,115,32,40,50,48,48,115,97,118,
-101,100,95,108,105,110,107,103,111,97,108,115,103,114,97,110,116,103,114,101,101
-,107,104,111,109,101,115,114,105,110,103,115,114,97,116,101,100,51,48,112,120,59
-,119,104,111,115,101,112,97,114,115,101,40,41,59,34,32,66,108,111,99,107,108,105
-,110,117,120,106,111,110,101,115,112,105,120,101,108,39,41,59,34,62,41,59,105,
-102,40,45,108,101,102,116,100,97,118,105,100,104,111,114,115,101,70,111,99,117,
-115,114,97,105,115,101,98,111,120,101,115,84,114,97,99,107,101,109,101,110,116,
-60,47,101,109,62,98,97,114,34,62,46,115,114,99,61,116,111,119,101,114,97,108,116
-,61,34,99,97,98,108,101,104,101,110,114,121,50,52,112,120,59,115,101,116,117,112
-,105,116,97,108,121,115,104,97,114,112,109,105,110,111,114,116,97,115,116,101,
-119,97,110,116,115,116,104,105,115,46,114,101,115,101,116,119,104,101,101,108,
-103,105,114,108,115,47,99,115,115,47,49,48,48,37,59,99,108,117,98,115,115,116,
-117,102,102,98,105,98,108,101,118,111,116,101,115,32,49,48,48,48,107,111,114,101
-,97,125,41,59,13,10,98,97,110,100,115,113,117,101,117,101,61,32,123,125,59,56,48
-,112,120,59,99,107,105,110,103,123,13,10,9,9,97,104,101,97,100,99,108,111,99,107
-,105,114,105,115,104,108,105,107,101,32,114,97,116,105,111,115,116,97,116,115,70
-,111,114,109,34,121,97,104,111,111,41,91,48,93,59,65,98,111,117,116,102,105,110,
-100,115,60,47,104,49,62,100,101,98,117,103,116,97,115,107,115,85,82,76,32,61,99,
-101,108,108,115,125,41,40,41,59,49,50,112,120,59,112,114,105,109,101,116,101,108
-,108,115,116,117,114,110,115,48,120,54,48,48,46,106,112,103,34,115,112,97,105,
-110,98,101,97,99,104,116,97,120,101,115,109,105,99,114,111,97,110,103,101,108,45
-,45,62,60,47,103,105,102,116,115,115,116,101,118,101,45,108,105,110,107,98,111,
-100,121,46,125,41,59,10,9,109,111,117,110,116,32,40,49,57,57,70,65,81,60,47,114,
-111,103,101,114,102,114,97,110,107,67,108,97,115,115,50,56,112,120,59,102,101,
-101,100,115,60,104,49,62,60,115,99,111,116,116,116,101,115,116,115,50,50,112,120
-,59,100,114,105,110,107,41,32,124,124,32,108,101,119,105,115,115,104,97,108,108,
-35,48,51,57,59,32,102,111,114,32,108,111,118,101,100,119,97,115,116,101,48,48,
-112,120,59,106,97,58,227,130,115,105,109,111,110,60,102,111,110,116,114,101,112,
-108,121,109,101,101,116,115,117,110,116,101,114,99,104,101,97,112,116,105,103,
-104,116,66,114,97,110,100,41,32,33,61,32,100,114,101,115,115,99,108,105,112,115,
-114,111,111,109,115,111,110,107,101,121,109,111,98,105,108,109,97,105,110,46,78,
-97,109,101,32,112,108,97,116,101,102,117,110,110,121,116,114,101,101,115,99,111,
-109,47,34,49,46,106,112,103,119,109,111,100,101,112,97,114,97,109,83,84,65,82,84
-,108,101,102,116,32,105,100,100,101,110,44,32,50,48,49,41,59,10,125,10,102,111,
-114,109,46,118,105,114,117,115,99,104,97,105,114,116,114,97,110,115,119,111,114,
-115,116,80,97,103,101,115,105,116,105,111,110,112,97,116,99,104,60,33,45,45,10,
-111,45,99,97,99,102,105,114,109,115,116,111,117,114,115,44,48,48,48,32,97,115,
-105,97,110,105,43,43,41,123,97,100,111,98,101,39,41,91,48,93,105,100,61,49,48,98
-,111,116,104,59,109,101,110,117,32,46,50,46,109,105,46,112,110,103,34,107,101,
-118,105,110,99,111,97,99,104,67,104,105,108,100,98,114,117,99,101,50,46,106,112,
-103,85,82,76,41,43,46,106,112,103,124,115,117,105,116,101,115,108,105,99,101,104
-,97,114,114,121,49,50,48,34,32,115,119,101,101,116,116,114,62,13,10,110,97,109,
-101,61,100,105,101,103,111,112,97,103,101,32,115,119,105,115,115,45,45,62,10,10,
-35,102,102,102,59,34,62,76,111,103,46,99,111,109,34,116,114,101,97,116,115,104,
-101,101,116,41,32,38,38,32,49,52,112,120,59,115,108,101,101,112,110,116,101,110,
-116,102,105,108,101,100,106,97,58,227,131,105,100,61,34,99,78,97,109,101,34,119,
-111,114,115,101,115,104,111,116,115,45,98,111,120,45,100,101,108,116,97,10,38,
-108,116,59,98,101,97,114,115,58,52,56,90,60,100,97,116,97,45,114,117,114,97,108,
-60,47,97,62,32,115,112,101,110,100,98,97,107,101,114,115,104,111,112,115,61,32,
-34,34,59,112,104,112,34,62,99,116,105,111,110,49,51,112,120,59,98,114,105,97,110
-,104,101,108,108,111,115,105,122,101,61,111,61,37,50,70,32,106,111,105,110,109,
-97,121,98,101,60,105,109,103,32,105,109,103,34,62,44,32,102,106,115,105,109,103,
-34,32,34,41,91,48,93,77,84,111,112,66,84,121,112,101,34,110,101,119,108,121,68,
-97,110,115,107,99,122,101,99,104,116,114,97,105,108,107,110,111,119,115,60,47,
-104,53,62,102,97,113,34,62,122,104,45,99,110,49,48,41,59,10,45,49,34,41,59,116,
-121,112,101,61,98,108,117,101,115,116,114,117,108,121,100,97,118,105,115,46,106,
-115,39,59,62,13,10,60,33,115,116,101,101,108,32,121,111,117,32,104,50,62,13,10,
-102,111,114,109,32,106,101,115,117,115,49,48,48,37,32,109,101,110,117,46,13,10,9
-,13,10,119,97,108,101,115,114,105,115,107,115,117,109,101,110,116,100,100,105,
-110,103,98,45,108,105,107,116,101,97,99,104,103,105,102,34,32,118,101,103,97,115
-,100,97,110,115,107,101,101,115,116,105,115,104,113,105,112,115,117,111,109,105,
-115,111,98,114,101,100,101,115,100,101,101,110,116,114,101,116,111,100,111,115,
-112,117,101,100,101,97,195,177,111,115,101,115,116,195,161,116,105,101,110,101,
-104,97,115,116,97,111,116,114,111,115,112,97,114,116,101,100,111,110,100,101,110
-,117,101,118,111,104,97,99,101,114,102,111,114,109,97,109,105,115,109,111,109,
-101,106,111,114,109,117,110,100,111,97,113,117,195,173,100,195,173,97,115,115,
-195,179,108,111,97,121,117,100,97,102,101,99,104,97,116,111,100,97,115,116,97,
-110,116,111,109,101,110,111,115,100,97,116,111,115,111,116,114,97,115,115,105,
-116,105,111,109,117,99,104,111,97,104,111,114,97,108,117,103,97,114,109,97,121,
-111,114,101,115,116,111,115,104,111,114,97,115,116,101,110,101,114,97,110,116,
-101,115,102,111,116,111,115,101,115,116,97,115,112,97,195,173,115,110,117,101,
-118,97,115,97,108,117,100,102,111,114,111,115,109,101,100,105,111,113,117,105,
-101,110,109,101,115,101,115,112,111,100,101,114,99,104,105,108,101,115,101,114,
-195,161,118,101,99,101,115,100,101,99,105,114,106,111,115,195,169,101,115,116,97
-,114,118,101,110,116,97,103,114,117,112,111,104,101,99,104,111,101,108,108,111,
-115,116,101,110,103,111,97,109,105,103,111,99,111,115,97,115,110,105,118,101,108
-,103,101,110,116,101,109,105,115,109,97,97,105,114,101,115,106,117,108,105,111,
-116,101,109,97,115,104,97,99,105,97,102,97,118,111,114,106,117,110,105,111,108,
-105,98,114,101,112,117,110,116,111,98,117,101,110,111,97,117,116,111,114,97,98,
-114,105,108,98,117,101,110,97,116,101,120,116,111,109,97,114,122,111,115,97,98,
-101,114,108,105,115,116,97,108,117,101,103,111,99,195,179,109,111,101,110,101,
-114,111,106,117,101,103,111,112,101,114,195,186,104,97,98,101,114,101,115,116,
-111,121,110,117,110,99,97,109,117,106,101,114,118,97,108,111,114,102,117,101,114
-,97,108,105,98,114,111,103,117,115,116,97,105,103,117,97,108,118,111,116,111,115
-,99,97,115,111,115,103,117,195,173,97,112,117,101,100,111,115,111,109,111,115,97
-,118,105,115,111,117,115,116,101,100,100,101,98,101,110,110,111,99,104,101,98,
-117,115,99,97,102,97,108,116,97,101,117,114,111,115,115,101,114,105,101,100,105,
-99,104,111,99,117,114,115,111,99,108,97,118,101,99,97,115,97,115,108,101,195,179
-,110,112,108,97,122,111,108,97,114,103,111,111,98,114,97,115,118,105,115,116,97,
-97,112,111,121,111,106,117,110,116,111,116,114,97,116,97,118,105,115,116,111,99,
-114,101,97,114,99,97,109,112,111,104,101,109,111,115,99,105,110,99,111,99,97,114
-,103,111,112,105,115,111,115,111,114,100,101,110,104,97,99,101,110,195,161,114,
-101,97,100,105,115,99,111,112,101,100,114,111,99,101,114,99,97,112,117,101,100,
-97,112,97,112,101,108,109,101,110,111,114,195,186,116,105,108,99,108,97,114,111,
-106,111,114,103,101,99,97,108,108,101,112,111,110,101,114,116,97,114,100,101,110
-,97,100,105,101,109,97,114,99,97,115,105,103,117,101,101,108,108,97,115,115,105,
-103,108,111,99,111,99,104,101,109,111,116,111,115,109,97,100,114,101,99,108,97,
-115,101,114,101,115,116,111,110,105,195,177,111,113,117,101,100,97,112,97,115,97
-,114,98,97,110,99,111,104,105,106,111,115,118,105,97,106,101,112,97,98,108,111,
-195,169,115,116,101,118,105,101,110,101,114,101,105,110,111,100,101,106,97,114,
-102,111,110,100,111,99,97,110,97,108,110,111,114,116,101,108,101,116,114,97,99,
-97,117,115,97,116,111,109,97,114,109,97,110,111,115,108,117,110,101,115,97,117,
-116,111,115,118,105,108,108,97,118,101,110,100,111,112,101,115,97,114,116,105,
-112,111,115,116,101,110,103,97,109,97,114,99,111,108,108,101,118,97,112,97,100,
-114,101,117,110,105,100,111,118,97,109,111,115,122,111,110,97,115,97,109,98,111,
-115,98,97,110,100,97,109,97,114,105,97,97,98,117,115,111,109,117,99,104,97,115,
-117,98,105,114,114,105,111,106,97,118,105,118,105,114,103,114,97,100,111,99,104,
-105,99,97,97,108,108,195,173,106,111,118,101,110,100,105,99,104,97,101,115,116,
-97,110,116,97,108,101,115,115,97,108,105,114,115,117,101,108,111,112,101,115,111
-,115,102,105,110,101,115,108,108,97,109,97,98,117,115,99,111,195,169,115,116,97,
-108,108,101,103,97,110,101,103,114,111,112,108,97,122,97,104,117,109,111,114,112
-,97,103,97,114,106,117,110,116,97,100,111,98,108,101,105,115,108,97,115,98,111,
-108,115,97,98,97,195,177,111,104,97,98,108,97,108,117,99,104,97,195,129,114,101,
-97,100,105,99,101,110,106,117,103,97,114,110,111,116,97,115,118,97,108,108,101,
-97,108,108,195,161,99,97,114,103,97,100,111,108,111,114,97,98,97,106,111,101,115
-,116,195,169,103,117,115,116,111,109,101,110,116,101,109,97,114,105,111,102,105,
-114,109,97,99,111,115,116,111,102,105,99,104,97,112,108,97,116,97,104,111,103,97
-,114,97,114,116,101,115,108,101,121,101,115,97,113,117,101,108,109,117,115,101,
-111,98,97,115,101,115,112,111,99,111,115,109,105,116,97,100,99,105,101,108,111,
-99,104,105,99,111,109,105,101,100,111,103,97,110,97,114,115,97,110,116,111,101,
-116,97,112,97,100,101,98,101,115,112,108,97,121,97,114,101,100,101,115,115,105,
-101,116,101,99,111,114,116,101,99,111,114,101,97,100,117,100,97,115,100,101,115,
-101,111,118,105,101,106,111,100,101,115,101,97,97,103,117,97,115,38,113,117,111,
-116,59,100,111,109,97,105,110,99,111,109,109,111,110,115,116,97,116,117,115,101,
-118,101,110,116,115,109,97,115,116,101,114,115,121,115,116,101,109,97,99,116,105
-,111,110,98,97,110,110,101,114,114,101,109,111,118,101,115,99,114,111,108,108,
-117,112,100,97,116,101,103,108,111,98,97,108,109,101,100,105,117,109,102,105,108
-,116,101,114,110,117,109,98,101,114,99,104,97,110,103,101,114,101,115,117,108,
-116,112,117,98,108,105,99,115,99,114,101,101,110,99,104,111,111,115,101,110,111,
-114,109,97,108,116,114,97,118,101,108,105,115,115,117,101,115,115,111,117,114,99
-,101,116,97,114,103,101,116,115,112,114,105,110,103,109,111,100,117,108,101,109,
-111,98,105,108,101,115,119,105,116,99,104,112,104,111,116,111,115,98,111,114,100
-,101,114,114,101,103,105,111,110,105,116,115,101,108,102,115,111,99,105,97,108,
-97,99,116,105,118,101,99,111,108,117,109,110,114,101,99,111,114,100,102,111,108,
-108,111,119,116,105,116,108,101,62,101,105,116,104,101,114,108,101,110,103,116,
-104,102,97,109,105,108,121,102,114,105,101,110,100,108,97,121,111,117,116,97,117
-,116,104,111,114,99,114,101,97,116,101,114,101,118,105,101,119,115,117,109,109,
-101,114,115,101,114,118,101,114,112,108,97,121,101,100,112,108,97,121,101,114,
-101,120,112,97,110,100,112,111,108,105,99,121,102,111,114,109,97,116,100,111,117
-,98,108,101,112,111,105,110,116,115,115,101,114,105,101,115,112,101,114,115,111,
-110,108,105,118,105,110,103,100,101,115,105,103,110,109,111,110,116,104,115,102,
-111,114,99,101,115,117,110,105,113,117,101,119,101,105,103,104,116,112,101,111,
-112,108,101,101,110,101,114,103,121,110,97,116,117,114,101,115,101,97,114,99,104
-,102,105,103,117,114,101,104,97,118,105,110,103,99,117,115,116,111,109,111,102,
-102,115,101,116,108,101,116,116,101,114,119,105,110,100,111,119,115,117,98,109,
-105,116,114,101,110,100,101,114,103,114,111,117,112,115,117,112,108,111,97,100,
-104,101,97,108,116,104,109,101,116,104,111,100,118,105,100,101,111,115,115,99,
-104,111,111,108,102,117,116,117,114,101,115,104,97,100,111,119,100,101,98,97,116
-,101,118,97,108,117,101,115,79,98,106,101,99,116,111,116,104,101,114,115,114,105
-,103,104,116,115,108,101,97,103,117,101,99,104,114,111,109,101,115,105,109,112,
-108,101,110,111,116,105,99,101,115,104,97,114,101,100,101,110,100,105,110,103,
-115,101,97,115,111,110,114,101,112,111,114,116,111,110,108,105,110,101,115,113,
-117,97,114,101,98,117,116,116,111,110,105,109,97,103,101,115,101,110,97,98,108,
-101,109,111,118,105,110,103,108,97,116,101,115,116,119,105,110,116,101,114,70,
-114,97,110,99,101,112,101,114,105,111,100,115,116,114,111,110,103,114,101,112,
-101,97,116,76,111,110,100,111,110,100,101,116,97,105,108,102,111,114,109,101,100
-,100,101,109,97,110,100,115,101,99,117,114,101,112,97,115,115,101,100,116,111,
-103,103,108,101,112,108,97,99,101,115,100,101,118,105,99,101,115,116,97,116,105,
-99,99,105,116,105,101,115,115,116,114,101,97,109,121,101,108,108,111,119,97,116,
-116,97,99,107,115,116,114,101,101,116,102,108,105,103,104,116,104,105,100,100,
-101,110,105,110,102,111,34,62,111,112,101,110,101,100,117,115,101,102,117,108,
-118,97,108,108,101,121,99,97,117,115,101,115,108,101,97,100,101,114,115,101,99,
-114,101,116,115,101,99,111,110,100,100,97,109,97,103,101,115,112,111,114,116,115
-,101,120,99,101,112,116,114,97,116,105,110,103,115,105,103,110,101,100,116,104,
-105,110,103,115,101,102,102,101,99,116,102,105,101,108,100,115,115,116,97,116,
-101,115,111,102,102,105,99,101,118,105,115,117,97,108,101,100,105,116,111,114,
-118,111,108,117,109,101,82,101,112,111,114,116,109,117,115,101,117,109,109,111,
-118,105,101,115,112,97,114,101,110,116,97,99,99,101,115,115,109,111,115,116,108,
-121,109,111,116,104,101,114,34,32,105,100,61,34,109,97,114,107,101,116,103,114,
-111,117,110,100,99,104,97,110,99,101,115,117,114,118,101,121,98,101,102,111,114,
-101,115,121,109,98,111,108,109,111,109,101,110,116,115,112,101,101,99,104,109,
-111,116,105,111,110,105,110,115,105,100,101,109,97,116,116,101,114,67,101,110,
-116,101,114,111,98,106,101,99,116,101,120,105,115,116,115,109,105,100,100,108,
-101,69,117,114,111,112,101,103,114,111,119,116,104,108,101,103,97,99,121,109,97,
-110,110,101,114,101,110,111,117,103,104,99,97,114,101,101,114,97,110,115,119,101
-,114,111,114,105,103,105,110,112,111,114,116,97,108,99,108,105,101,110,116,115,
-101,108,101,99,116,114,97,110,100,111,109,99,108,111,115,101,100,116,111,112,105
-,99,115,99,111,109,105,110,103,102,97,116,104,101,114,111,112,116,105,111,110,
-115,105,109,112,108,121,114,97,105,115,101,100,101,115,99,97,112,101,99,104,111,
-115,101,110,99,104,117,114,99,104,100,101,102,105,110,101,114,101,97,115,111,110
-,99,111,114,110,101,114,111,117,116,112,117,116,109,101,109,111,114,121,105,102,
-114,97,109,101,112,111,108,105,99,101,109,111,100,101,108,115,78,117,109,98,101,
-114,100,117,114,105,110,103,111,102,102,101,114,115,115,116,121,108,101,115,107,
-105,108,108,101,100,108,105,115,116,101,100,99,97,108,108,101,100,115,105,108,
-118,101,114,109,97,114,103,105,110,100,101,108,101,116,101,98,101,116,116,101,
-114,98,114,111,119,115,101,108,105,109,105,116,115,71,108,111,98,97,108,115,105,
-110,103,108,101,119,105,100,103,101,116,99,101,110,116,101,114,98,117,100,103,
-101,116,110,111,119,114,97,112,99,114,101,100,105,116,99,108,97,105,109,115,101,
-110,103,105,110,101,115,97,102,101,116,121,99,104,111,105,99,101,115,112,105,114
-,105,116,45,115,116,121,108,101,115,112,114,101,97,100,109,97,107,105,110,103,
-110,101,101,100,101,100,114,117,115,115,105,97,112,108,101,97,115,101,101,120,
-116,101,110,116,83,99,114,105,112,116,98,114,111,107,101,110,97,108,108,111,119,
-115,99,104,97,114,103,101,100,105,118,105,100,101,102,97,99,116,111,114,109,101,
-109,98,101,114,45,98,97,115,101,100,116,104,101,111,114,121,99,111,110,102,105,
-103,97,114,111,117,110,100,119,111,114,107,101,100,104,101,108,112,101,100,67,
-104,117,114,99,104,105,109,112,97,99,116,115,104,111,117,108,100,97,108,119,97,
-121,115,108,111,103,111,34,32,98,111,116,116,111,109,108,105,115,116,34,62,41,
-123,118,97,114,32,112,114,101,102,105,120,111,114,97,110,103,101,72,101,97,100,
-101,114,46,112,117,115,104,40,99,111,117,112,108,101,103,97,114,100,101,110,98,
-114,105,100,103,101,108,97,117,110,99,104,82,101,118,105,101,119,116,97,107,105,
-110,103,118,105,115,105,111,110,108,105,116,116,108,101,100,97,116,105,110,103,
-66,117,116,116,111,110,98,101,97,117,116,121,116,104,101,109,101,115,102,111,114
-,103,111,116,83,101,97,114,99,104,97,110,99,104,111,114,97,108,109,111,115,116,
-108,111,97,100,101,100,67,104,97,110,103,101,114,101,116,117,114,110,115,116,114
-,105,110,103,114,101,108,111,97,100,77,111,98,105,108,101,105,110,99,111,109,101
-,115,117,112,112,108,121,83,111,117,114,99,101,111,114,100,101,114,115,118,105,
-101,119,101,100,38,110,98,115,112,59,99,111,117,114,115,101,65,98,111,117,116,32
-,105,115,108,97,110,100,60,104,116,109,108,32,99,111,111,107,105,101,110,97,109,
-101,61,34,97,109,97,122,111,110,109,111,100,101,114,110,97,100,118,105,99,101,
-105,110,60,47,97,62,58,32,84,104,101,32,100,105,97,108,111,103,104,111,117,115,
-101,115,66,69,71,73,78,32,77,101,120,105,99,111,115,116,97,114,116,115,99,101,
-110,116,114,101,104,101,105,103,104,116,97,100,100,105,110,103,73,115,108,97,110
-,100,97,115,115,101,116,115,69,109,112,105,114,101,83,99,104,111,111,108,101,102
-,102,111,114,116,100,105,114,101,99,116,110,101,97,114,108,121,109,97,110,117,97
-,108,83,101,108,101,99,116,46,10,10,79,110,101,106,111,105,110,101,100,109,101,
-110,117,34,62,80,104,105,108,105,112,97,119,97,114,100,115,104,97,110,100,108,
-101,105,109,112,111,114,116,79,102,102,105,99,101,114,101,103,97,114,100,115,107
-,105,108,108,115,110,97,116,105,111,110,83,112,111,114,116,115,100,101,103,114,
-101,101,119,101,101,107,108,121,32,40,101,46,103,46,98,101,104,105,110,100,100,
-111,99,116,111,114,108,111,103,103,101,100,117,110,105,116,101,100,60,47,98,62,
-60,47,98,101,103,105,110,115,112,108,97,110,116,115,97,115,115,105,115,116,97,
-114,116,105,115,116,105,115,115,117,101,100,51,48,48,112,120,124,99,97,110,97,
-100,97,97,103,101,110,99,121,115,99,104,101,109,101,114,101,109,97,105,110,66,
-114,97,122,105,108,115,97,109,112,108,101,108,111,103,111,34,62,98,101,121,111,
-110,100,45,115,99,97,108,101,97,99,99,101,112,116,115,101,114,118,101,100,109,97
-,114,105,110,101,70,111,111,116,101,114,99,97,109,101,114,97,60,47,104,49,62,10,
-95,102,111,114,109,34,108,101,97,118,101,115,115,116,114,101,115,115,34,32,47,62
-,13,10,46,103,105,102,34,32,111,110,108,111,97,100,108,111,97,100,101,114,79,120
-,102,111,114,100,115,105,115,116,101,114,115,117,114,118,105,118,108,105,115,116
-,101,110,102,101,109,97,108,101,68,101,115,105,103,110,115,105,122,101,61,34,97,
-112,112,101,97,108,116,101,120,116,34,62,108,101,118,101,108,115,116,104,97,110,
-107,115,104,105,103,104,101,114,102,111,114,99,101,100,97,110,105,109,97,108,97,
-110,121,111,110,101,65,102,114,105,99,97,97,103,114,101,101,100,114,101,99,101,
-110,116,80,101,111,112,108,101,60,98,114,32,47,62,119,111,110,100,101,114,112,
-114,105,99,101,115,116,117,114,110,101,100,124,124,32,123,125,59,109,97,105,110,
-34,62,105,110,108,105,110,101,115,117,110,100,97,121,119,114,97,112,34,62,102,97
-,105,108,101,100,99,101,110,115,117,115,109,105,110,117,116,101,98,101,97,99,111
-,110,113,117,111,116,101,115,49,53,48,112,120,124,101,115,116,97,116,101,114,101
-,109,111,116,101,101,109,97,105,108,34,108,105,110,107,101,100,114,105,103,104,
-116,59,115,105,103,110,97,108,102,111,114,109,97,108,49,46,104,116,109,108,115,
-105,103,110,117,112,112,114,105,110,99,101,102,108,111,97,116,58,46,112,110,103,
-34,32,102,111,114,117,109,46,65,99,99,101,115,115,112,97,112,101,114,115,115,111
-,117,110,100,115,101,120,116,101,110,100,72,101,105,103,104,116,115,108,105,100,
-101,114,85,84,70,45,56,34,38,97,109,112,59,32,66,101,102,111,114,101,46,32,87,
-105,116,104,115,116,117,100,105,111,111,119,110,101,114,115,109,97,110,97,103,
-101,112,114,111,102,105,116,106,81,117,101,114,121,97,110,110,117,97,108,112,97,
-114,97,109,115,98,111,117,103,104,116,102,97,109,111,117,115,103,111,111,103,108
-,101,108,111,110,103,101,114,105,43,43,41,32,123,105,115,114,97,101,108,115,97,
-121,105,110,103,100,101,99,105,100,101,104,111,109,101,34,62,104,101,97,100,101,
-114,101,110,115,117,114,101,98,114,97,110,99,104,112,105,101,99,101,115,98,108,
-111,99,107,59,115,116,97,116,101,100,116,111,112,34,62,60,114,97,99,105,110,103,
-114,101,115,105,122,101,45,45,38,103,116,59,112,97,99,105,116,121,115,101,120,
-117,97,108,98,117,114,101,97,117,46,106,112,103,34,32,49,48,44,48,48,48,111,98,
-116,97,105,110,116,105,116,108,101,115,97,109,111,117,110,116,44,32,73,110,99,46
-,99,111,109,101,100,121,109,101,110,117,34,32,108,121,114,105,99,115,116,111,100
-,97,121,46,105,110,100,101,101,100,99,111,117,110,116,121,95,108,111,103,111,46,
-70,97,109,105,108,121,108,111,111,107,101,100,77,97,114,107,101,116,108,115,101,
-32,105,102,80,108,97,121,101,114,116,117,114,107,101,121,41,59,118,97,114,32,102
-,111,114,101,115,116,103,105,118,105,110,103,101,114,114,111,114,115,68,111,109,
-97,105,110,125,101,108,115,101,123,105,110,115,101,114,116,66,108,111,103,60,47,
-102,111,111,116,101,114,108,111,103,105,110,46,102,97,115,116,101,114,97,103,101
-,110,116,115,60,98,111,100,121,32,49,48,112,120,32,48,112,114,97,103,109,97,102,
-114,105,100,97,121,106,117,110,105,111,114,100,111,108,108,97,114,112,108,97,99,
-101,100,99,111,118,101,114,115,112,108,117,103,105,110,53,44,48,48,48,32,112,97,
-103,101,34,62,98,111,115,116,111,110,46,116,101,115,116,40,97,118,97,116,97,114,
-116,101,115,116,101,100,95,99,111,117,110,116,102,111,114,117,109,115,115,99,104
-,101,109,97,105,110,100,101,120,44,102,105,108,108,101,100,115,104,97,114,101,
-115,114,101,97,100,101,114,97,108,101,114,116,40,97,112,112,101,97,114,83,117,98
-,109,105,116,108,105,110,101,34,62,98,111,100,121,34,62,10,42,32,84,104,101,84,
-104,111,117,103,104,115,101,101,105,110,103,106,101,114,115,101,121,78,101,119,
-115,60,47,118,101,114,105,102,121,101,120,112,101,114,116,105,110,106,117,114,
-121,119,105,100,116,104,61,67,111,111,107,105,101,83,84,65,82,84,32,97,99,114,
-111,115,115,95,105,109,97,103,101,116,104,114,101,97,100,110,97,116,105,118,101,
-112,111,99,107,101,116,98,111,120,34,62,10,83,121,115,116,101,109,32,68,97,118,
-105,100,99,97,110,99,101,114,116,97,98,108,101,115,112,114,111,118,101,100,65,
-112,114,105,108,32,114,101,97,108,108,121,100,114,105,118,101,114,105,116,101,
-109,34,62,109,111,114,101,34,62,98,111,97,114,100,115,99,111,108,111,114,115,99,
-97,109,112,117,115,102,105,114,115,116,32,124,124,32,91,93,59,109,101,100,105,97
-,46,103,117,105,116,97,114,102,105,110,105,115,104,119,105,100,116,104,58,115,
-104,111,119,101,100,79,116,104,101,114,32,46,112,104,112,34,32,97,115,115,117,
-109,101,108,97,121,101,114,115,119,105,108,115,111,110,115,116,111,114,101,115,
-114,101,108,105,101,102,115,119,101,100,101,110,67,117,115,116,111,109,101,97,
-115,105,108,121,32,121,111,117,114,32,83,116,114,105,110,103,10,10,87,104,105,
-108,116,97,121,108,111,114,99,108,101,97,114,58,114,101,115,111,114,116,102,114,
-101,110,99,104,116,104,111,117,103,104,34,41,32,43,32,34,60,98,111,100,121,62,98
-,117,121,105,110,103,98,114,97,110,100,115,77,101,109,98,101,114,110,97,109,101,
-34,62,111,112,112,105,110,103,115,101,99,116,111,114,53,112,120,59,34,62,118,115
-,112,97,99,101,112,111,115,116,101,114,109,97,106,111,114,32,99,111,102,102,101,
-101,109,97,114,116,105,110,109,97,116,117,114,101,104,97,112,112,101,110,60,47,
-110,97,118,62,107,97,110,115,97,115,108,105,110,107,34,62,73,109,97,103,101,115,
-61,102,97,108,115,101,119,104,105,108,101,32,104,115,112,97,99,101,48,38,97,109,
-112,59,32,10,10,73,110,32,32,112,111,119,101,114,80,111,108,115,107,105,45,99,
-111,108,111,114,106,111,114,100,97,110,66,111,116,116,111,109,83,116,97,114,116,
-32,45,99,111,117,110,116,50,46,104,116,109,108,110,101,119,115,34,62,48,49,46,
-106,112,103,79,110,108,105,110,101,45,114,105,103,104,116,109,105,108,108,101,
-114,115,101,110,105,111,114,73,83,66,78,32,48,48,44,48,48,48,32,103,117,105,100,
-101,115,118,97,108,117,101,41,101,99,116,105,111,110,114,101,112,97,105,114,46,
-120,109,108,34,32,32,114,105,103,104,116,115,46,104,116,109,108,45,98,108,111,99
-,107,114,101,103,69,120,112,58,104,111,118,101,114,119,105,116,104,105,110,118,
-105,114,103,105,110,112,104,111,110,101,115,60,47,116,114,62,13,117,115,105,110,
-103,32,10,9,118,97,114,32,62,39,41,59,10,9,60,47,116,100,62,10,60,47,116,114,62,
-10,98,97,104,97,115,97,98,114,97,115,105,108,103,97,108,101,103,111,109,97,103,
-121,97,114,112,111,108,115,107,105,115,114,112,115,107,105,216,177,216,175,217,
-136,228,184,173,230,150,135,231,174,128,228,189,147,231,185,129,233,171,148,228,
-191,161,230,129,175,228,184,173,229,155,189,230,136,145,228,187,172,228,184,128,
-228,184,170,229,133,172,229,143,184,231,174,161,231,144,134,232,174,186,229,157,
-155,229,143,175,228,187,165,230,156,141,229,138,161,230,151,182,233,151,180,228,
-184,170,228,186,186,228,186,167,229,147,129,232,135,170,229,183,177,228,188,129,
-228,184,154,230,159,165,231,156,139,229,183,165,228,189,156,232,129,148,231,179,
-187,230,178,161,230,156,137,231,189,145,231,171,153,230,137,128,230,156,137,232,
-175,132,232,174,186,228,184,173,229,191,131,230,150,135,231,171,160,231,148,168,
-230,136,183,233,166,150,233,161,181,228,189,156,232,128,133,230,138,128,230,156,
-175,233,151,174,233,162,152,231,155,184,229,133,179,228,184,139,232,189,189,230,
-144,156,231,180,162,228,189,191,231,148,168,232,189,175,228,187,182,229,156,168,
-231,186,191,228,184,187,233,162,152,232,181,132,230,150,153,232,167,134,233,162,
-145,229,155,158,229,164,141,230,179,168,229,134,140,231,189,145,231,187,156,230,
-148,182,232,151,143,229,134,133,229,174,185,230,142,168,232,141,144,229,184,130,
-229,156,186,230,182,136,230,129,175,231,169,186,233,151,180,229,143,145,229,184,
-131,228,187,128,228,185,136,229,165,189,229,143,139,231,148,159,230,180,187,229,
-155,190,231,137,135,229,143,145,229,177,149,229,166,130,230,158,156,230,137,139,
-230,156,186,230,150,176,233,151,187,230,156,128,230,150,176,230,150,185,229,188,
-143,229,140,151,228,186,172,230,143,144,228,190,155,229,133,179,228,186,142,230,
-155,180,229,164,154,232,191,153,228,184,170,231,179,187,231,187,159,231,159,165,
-233,129,147,230,184,184,230,136,143,229,185,191,229,145,138,229,133,182,228,187,
-150,229,143,145,232,161,168,229,174,137,229,133,168,231,172,172,228,184,128,228,
-188,154,229,145,152,232,191,155,232,161,140,231,130,185,229,135,187,231,137,136,
-230,157,131,231,148,181,229,173,144,228,184,150,231,149,140,232,174,190,232,174,
-161,229,133,141,232,180,185,230,149,153,232,130,178,229,138,160,229,133,165,230,
-180,187,229,138,168,228,187,150,228,187,172,229,149,134,229,147,129,229,141,154,
-229,174,162,231,142,176,229,156,168,228,184,138,230,181,183,229,166,130,228,189,
-149,229,183,178,231,187,143,231,149,153,232,168,128,232,175,166,231,187,134,231,
-164,190,229,140,186,231,153,187,229,189,149,230,156,172,231,171,153,233,156,128,
-232,166,129,228,187,183,230,160,188,230,148,175,230,140,129,229,155,189,233,153,
-133,233,147,190,230,142,165,229,155,189,229,174,182,229,187,186,232,174,190,230,
-156,139,229,143,139,233,152,133,232,175,187,230,179,149,229,190,139,228,189,141,
-231,189,174,231,187,143,230,181,142,233,128,137,230,139,169,232,191,153,230,160,
-183,229,189,147,229,137,141,229,136,134,231,177,187,230,142,146,232,161,140,229,
-155,160,228,184,186,228,186,164,230,152,147,230,156,128,229,144,142,233,159,179,
-228,185,144,228,184,141,232,131,189,233,128,154,232,191,135,232,161,140,228,184,
-154,231,167,145,230,138,128,229,143,175,232,131,189,232,174,190,229,164,135,229,
-144,136,228,189,156,229,164,167,229,174,182,231,164,190,228,188,154,231,160,148,
-231,169,182,228,184,147,228,184,154,229,133,168,233,131,168,233,161,185,231,155,
-174,232,191,153,233,135,140,232,191,152,230,152,175,229,188,128,229,167,139,230,
-131,133,229,134,181,231,148,181,232,132,145,230,150,135,228,187,182,229,147,129,
-231,137,140,229,184,174,229,138,169,230,150,135,229,140,150,232,181,132,230,186,
-144,229,164,167,229,173,166,229,173,166,228,185,160,229,156,176,229,157,128,230,
-181,143,232,167,136,230,138,149,232,181,132,229,183,165,231,168,139,232,166,129,
-230,177,130,230,128,142,228,185,136,230,151,182,229,128,153,229,138,159,232,131,
-189,228,184,187,232,166,129,231,155,174,229,137,141,232,181,132,232,174,175,229,
-159,142,229,184,130,230,150,185,230,179,149,231,148,181,229,189,177,230,139,155,
-232,129,152,229,163,176,230,152,142,228,187,187,228,189,149,229,129,165,229,186,
-183,230,149,176,230,141,174,231,190,142,229,155,189,230,177,189,232,189,166,228,
-187,139,231,187,141,228,189,134,230,152,175,228,186,164,230,181,129,231,148,159,
-228,186,167,230,137,128,228,187,165,231,148,181,232,175,157,230,152,190,231,164,
-186,228,184,128,228,186,155,229,141,149,228,189,141,228,186,186,229,145,152,229,
-136,134,230,158,144,229,156,176,229,155,190,230,151,133,230,184,184,229,183,165,
-229,133,183,229,173,166,231,148,159,231,179,187,229,136,151,231,189,145,229,143,
-139,229,184,150,229,173,144,229,175,134,231,160,129,233,162,145,233,129,147,230,
-142,167,229,136,182,229,156,176,229,140,186,229,159,186,230,156,172,229,133,168,
-229,155,189,231,189,145,228,184,138,233,135,141,232,166,129,231,172,172,228,186,
-140,229,150,156,230,172,162,232,191,155,229,133,165,229,143,139,230,131,133,232,
-191,153,228,186,155,232,128,131,232,175,149,229,143,145,231,142,176,229,159,185,
-232,174,173,228,187,165,228,184,138,230,148,191,229,186,156,230,136,144,228,184,
-186,231,142,175,229,162,131,233,166,153,230,184,175,229,144,140,230,151,182,229,
-168,177,228,185,144,229,143,145,233,128,129,228,184,128,229,174,154,229,188,128,
-229,143,145,228,189,156,229,147,129,230,160,135,229,135,134,230,172,162,232,191,
-142,232,167,163,229,134,179,229,156,176,230,150,185,228,184,128,228,184,139,228,
-187,165,229,143,138,232,180,163,228,187,187,230,136,150,232,128,133,229,174,162,
-230,136,183,228,187,163,232,161,168,231,167,175,229,136,134,229,165,179,228,186,
-186,230,149,176,231,160,129,233,148,128,229,148,174,229,135,186,231,142,176,231,
-166,187,231,186,191,229,186,148,231,148,168,229,136,151,232,161,168,228,184,141,
-229,144,140,231,188,150,232,190,145,231,187,159,232,174,161,230,159,165,232,175,
-162,228,184,141,232,166,129,230,156,137,229,133,179,230,156,186,230,158,132,229,
-190,136,229,164,154,230,146,173,230,148,190,231,187,132,231,187,135,230,148,191,
-231,173,150,231,155,180,230,142,165,232,131,189,229,138,155,230,157,165,230,186,
-144,230,153,130,233,150,147,231,156,139,229,136,176,231,131,173,233,151,168,229,
-133,179,233,148,174,228,184,147,229,140,186,233,157,158,229,184,184,232,139,177,
-232,175,173,231,153,190,229,186,166,229,184,140,230,156,155,231,190,142,229,165,
-179,230,175,148,232,190,131,231,159,165,232,175,134,232,167,132,229,174,154,229,
-187,186,232,174,174,233,131,168,233,151,168,230,132,143,232,167,129,231,178,190,
-229,189,169,230,151,165,230,156,172,230,143,144,233,171,152,229,143,145,232,168,
-128,230,150,185,233,157,162,229,159,186,233,135,145,229,164,132,231,144,134,230,
-157,131,233,153,144,229,189,177,231,137,135,233,147,182,232,161,140,232,191,152,
-230,156,137,229,136,134,228,186,171,231,137,169,229,147,129,231,187,143,232,144,
-165,230,183,187,229,138,160,228,184,147,229,174,182,232,191,153,231,167,141,232,
-175,157,233,162,152,232,181,183,230,157,165,228,184,154,229,138,161,229,133,172,
-229,145,138,232,174,176,229,189,149,231,174,128,228,187,139,232,180,168,233,135,
-143,231,148,183,228,186,186,229,189,177,229,147,141,229,188,149,231,148,168,230,
-138,165,229,145,138,233,131,168,229,136,134,229,191,171,233,128,159,229,146,168,
-232,175,162,230,151,182,229,176,154,230,179,168,230,132,143,231,148,179,232,175,
-183,229,173,166,230,160,161,229,186,148,232,175,165,229,142,134,229,143,178,229,
-143,170,230,152,175,232,191,148,229,155,158,232,180,173,228,185,176,229,144,141,
-231,167,176,228,184,186,228,186,134,230,136,144,229,138,159,232,175,180,230,152,
-142,228,190,155,229,186,148,229,173,169,229,173,144,228,184,147,233,162,152,231,
-168,139,229,186,143,228,184,128,232,136,172,230,156,131,229,147,161,229,143,170,
-230,156,137,229,133,182,229,174,131,228,191,157,230,138,164,232,128,140,228,184,
-148,228,187,138,229,164,169,231,170,151,229,143,163,229,138,168,230,128,129,231,
-138,182,230,128,129,231,137,185,229,136,171,232,174,164,228,184,186,229,191,133,
-233,161,187,230,155,180,230,150,176,229,176,143,232,175,180,230,136,145,229,128,
-145,228,189,156,228,184,186,229,170,146,228,189,147,229,140,133,230,139,172,233,
-130,163,228,185,136,228,184,128,230,160,183,229,155,189,229,134,133,230,152,175,
-229,144,166,230,160,185,230,141,174,231,148,181,232,167,134,229,173,166,233,153,
-162,229,133,183,230,156,137,232,191,135,231,168,139,231,148,177,228,186,142,228,
-186,186,230,137,141,229,135,186,230,157,165,228,184,141,232,191,135,230,173,163,
-229,156,168,230,152,142,230,152,159,230,149,133,228,186,139,229,133,179,231,179,
-187,230,160,135,233,162,152,229,149,134,229,138,161,232,190,147,229,133,165,228,
-184,128,231,155,180,229,159,186,231,161,128,230,149,153,229,173,166,228,186,134,
-232,167,163,229,187,186,231,173,145,231,187,147,230,158,156,229,133,168,231,144,
-131,233,128,154,231,159,165,232,174,161,229,136,146,229,175,185,228,186,142,232,
-137,186,230,156,175,231,155,184,229,134,140,229,143,145,231,148,159,231,156,159,
-231,154,132,229,187,186,231,171,139,231,173,137,231,186,167,231,177,187,229,158,
-139,231,187,143,233,170,140,229,174,158,231,142,176,229,136,182,228,189,156,230,
-157,165,232,135,170,230,160,135,231,173,190,228,187,165,228,184,139,229,142,159,
-229,136,155,230,151,160,230,179,149,229,133,182,228,184,173,229,128,139,228,186,
-186,228,184,128,229,136,135,230,140,135,229,141,151,229,133,179,233,151,173,233,
-155,134,229,155,162,231,172,172,228,184,137,229,133,179,230,179,168,229,155,160,
-230,173,164,231,133,167,231,137,135,230,183,177,229,156,179,229,149,134,228,184,
-154,229,185,191,229,183,158,230,151,165,230,156,159,233,171,152,231,186,167,230,
-156,128,232,191,145,231,187,188,229,144,136,232,161,168,231,164,186,228,184,147,
-232,190,145,232,161,140,228,184,186,228,186,164,233,128,154,232,175,132,228,187,
-183,232,167,137,229,190,151,231,178,190,229,141,142,229,174,182,229,186,173,229,
-174,140,230,136,144,230,132,159,232,167,137,229,174,137,232,163,133,229,190,151,
-229,136,176,233,130,174,228,187,182,229,136,182,229,186,166,233,163,159,229,147,
-129,232,153,189,231,132,182,232,189,172,232,189,189,230,138,165,228,187,183,232,
-174,176,232,128,133,230,150,185,230,161,136,232,161,140,230,148,191,228,186,186,
-230,176,145,231,148,168,229,147,129,228,184,156,232,165,191,230,143,144,229,135,
-186,233,133,146,229,186,151,231,132,182,229,144,142,228,187,152,230,172,190,231,
-131,173,231,130,185,228,187,165,229,137,141,229,174,140,229,133,168,229,143,145,
-229,184,150,232,174,190,231,189,174,233,162,134,229,175,188,229,183,165,228,184,
-154,229,140,187,233,153,162,231,156,139,231,156,139,231,187,143,229,133,184,229,
-142,159,229,155,160,229,185,179,229,143,176,229,144,132,231,167,141,229,162,158,
-229,138,160,230,157,144,230,150,153,230,150,176,229,162,158,228,185,139,229,144,
-142,232,129,140,228,184,154,230,149,136,230,158,156,228,187,138,229,185,180,232,
-174,186,230,150,135,230,136,145,229,155,189,229,145,138,232,175,137,231,137,136,
-228,184,187,228,191,174,230,148,185,229,143,130,228,184,142,230,137,147,229,141,
-176,229,191,171,228,185,144,230,156,186,230,162,176,232,167,130,231,130,185,229,
-173,152,229,156,168,231,178,190,231,165,158,232,142,183,229,190,151,229,136,169,
-231,148,168,231,187,167,231,187,173,228,189,160,228,187,172,232,191,153,228,185,
-136,230,168,161,229,188,143,232,175,173,232,168,128,232,131,189,229,164,159,233,
-155,133,232,153,142,230,147,141,228,189,156,233,163,142,230,160,188,228,184,128,
-232,181,183,231,167,145,229,173,166,228,189,147,232,130,178,231,159,173,228,191,
-161,230,157,161,228,187,182,230,178,187,231,150,151,232,191,144,229,138,168,228,
-186,167,228,184,154,228,188,154,232,174,174,229,175,188,232,136,170,229,133,136,
-231,148,159,232,129,148,231,155,159,229,143,175,230,152,175,229,149,143,233,161,
-140,231,187,147,230,158,132,228,189,156,231,148,168,232,176,131,230,159,165,232,
-179,135,230,150,153,232,135,170,229,138,168,232,180,159,232,180,163,229,134,156,
-228,184,154,232,174,191,233,151,174,229,174,158,230,150,189,230,142,165,229,143,
-151,232,174,168,232,174,186,233,130,163,228,184,170,229,143,141,233,166,136,229,
-138,160,229,188,186,229,165,179,230,128,167,232,140,131,229,155,180,230,156,141,
-229,139,153,228,188,145,233,151,178,228,187,138,230,151,165,229,174,162,230,156,
-141,232,167,128,231,156,139,229,143,130,229,138,160,231,154,132,232,175,157,228,
-184,128,231,130,185,228,191,157,232,175,129,229,155,190,228,185,166,230,156,137,
-230,149,136,230,181,139,232,175,149,231,167,187,229,138,168,230,137,141,232,131,
-189,229,134,179,229,174,154,232,130,161,231,165,168,228,184,141,230,150,173,233,
-156,128,230,177,130,228,184,141,229,190,151,229,138,158,230,179,149,228,185,139,
-233,151,180,233,135,135,231,148,168,232,144,165,233,148,128,230,138,149,232,175,
-137,231,155,174,230,160,135,231,136,177,230,131,133,230,145,132,229,189,177,230,
-156,137,228,186,155,232,164,135,232,163,189,230,150,135,229,173,166,230,156,186,
-228,188,154,230,149,176,229,173,151,232,163,133,228,191,174,232,180,173,231,137,
-169,229,134,156,230,157,145,229,133,168,233,157,162,231,178,190,229,147,129,229,
-133,182,229,174,158,228,186,139,230,131,133,230,176,180,229,185,179,230,143,144,
-231,164,186,228,184,138,229,184,130,232,176,162,232,176,162,230,153,174,233,128,
-154,230,149,153,229,184,136,228,184,138,228,188,160,231,177,187,229,136,171,230,
-173,140,230,155,178,230,139,165,230,156,137,229,136,155,230,150,176,233,133,141,
-228,187,182,229,143,170,232,166,129,230,151,182,228,187,163,232,179,135,232,168,
-138,232,190,190,229,136,176,228,186,186,231,148,159,232,174,162,233,152,133,232,
-128,129,229,184,136,229,177,149,231,164,186,229,191,131,231,144,134,232,180,180,
-229,173,144,231,182,178,231,171,153,228,184,187,233,161,140,232,135,170,231,132,
-182,231,186,167,229,136,171,231,174,128,229,141,149,230,148,185,233,157,169,233,
-130,163,228,186,155,230,157,165,232,175,180,230,137,147,229,188,128,228,187,163,
-231,160,129,229,136,160,233,153,164,232,175,129,229,136,184,232,138,130,231,155,
-174,233,135,141,231,130,185,230,172,161,230,149,184,229,164,154,229,176,145,232,
-167,132,229,136,146,232,181,132,233,135,145,230,137,190,229,136,176,228,187,165,
-229,144,142,229,164,167,229,133,168,228,184,187,233,161,181,230,156,128,228,189,
-179,229,155,158,231,173,148,229,164,169,228,184,139,228,191,157,233,154,156,231,
-142,176,228,187,163,230,163,128,230,159,165,230,138,149,231,165,168,229,176,143,
-230,151,182,230,178,146,230,156,137,230,173,163,229,184,184,231,148,154,232,135,
-179,228,187,163,231,144,134,231,155,174,229,189,149,229,133,172,229,188,128,229,
-164,141,229,136,182,233,135,145,232,158,141,229,185,184,231,166,143,231,137,136,
-230,156,172,229,189,162,230,136,144,229,135,134,229,164,135,232,161,140,230,131,
-133,229,155,158,229,136,176,230,128,157,230,131,179,230,128,142,230,160,183,229,
-141,143,232,174,174,232,174,164,232,175,129,230,156,128,229,165,189,228,186,167,
-231,148,159,230,140,137,231,133,167,230,156,141,232,163,133,229,185,191,228,184,
-156,229,138,168,230,188,171,233,135,135,232,180,173,230,150,176,230,137,139,231,
-187,132,229,155,190,233,157,162,230,157,191,229,143,130,232,128,131,230,148,191,
-230,178,187,229,174,185,230,152,147,229,164,169,229,156,176,229,138,170,229,138,
-155,228,186,186,228,187,172,229,141,135,231,186,167,233,128,159,229,186,166,228,
-186,186,231,137,169,232,176,131,230,149,180,230,181,129,232,161,140,233,128,160,
-230,136,144,230,150,135,229,173,151,233,159,169,229,155,189,232,180,184,230,152,
-147,229,188,128,229,177,149,231,155,184,233,151,156,232,161,168,231,142,176,229,
-189,177,232,167,134,229,166,130,230,173,164,231,190,142,229,174,185,229,164,167,
-229,176,143,230,138,165,233,129,147,230,157,161,230,172,190,229,191,131,230,131,
-133,232,174,184,229,164,154,230,179,149,232,167,132,229,174,182,229,177,133,228,
-185,166,229,186,151,232,191,158,230,142,165,231,171,139,229,141,179,228,184,190,
-230,138,165,230,138,128,229,183,167,229,165,165,232,191,144,231,153,187,229,133,
-165,228,187,165,230,157,165,231,144,134,232,174,186,228,186,139,228,187,182,232,
-135,170,231,148,177,228,184,173,229,141,142,229,138,158,229,133,172,229,166,136,
-229,166,136,231,156,159,230,173,163,228,184,141,233,148,153,229,133,168,230,150,
-135,229,144,136,229,144,140,228,187,183,229,128,188,229,136,171,228,186,186,231,
-155,145,231,157,163,229,133,183,228,189,147,228,184,150,231,186,170,229,155,162,
-233,152,159,229,136,155,228,184,154,230,137,191,230,139,133,229,162,158,233,149,
-191,230,156,137,228,186,186,228,191,157,230,140,129,229,149,134,229,174,182,231,
-187,180,228,191,174,229,143,176,230,185,190,229,183,166,229,143,179,232,130,161,
-228,187,189,231,173,148,230,161,136,229,174,158,233,153,133,231,148,181,228,191,
-161,231,187,143,231,144,134,231,148,159,229,145,189,229,174,163,228,188,160,228,
-187,187,229,138,161,230,173,163,229,188,143,231,137,185,232,137,178,228,184,139,
-230,157,165,229,141,143,228,188,154,229,143,170,232,131,189,229,189,147,231,132,
-182,233,135,141,230,150,176,229,133,167,229,174,185,230,140,135,229,175,188,232,
-191,144,232,161,140,230,151,165,229,191,151,232,179,163,229,174,182,232,182,133,
-232,191,135,229,156,159,229,156,176,230,181,153,230,177,159,230,148,175,228,187,
-152,230,142,168,229,135,186,231,171,153,233,149,191,230,157,173,229,183,158,230,
-137,167,232,161,140,229,136,182,233,128,160,228,185,139,228,184,128,230,142,168,
-229,185,191,231,142,176,229,156,186,230,143,143,232,191,176,229,143,152,229,140,
-150,228,188,160,231,187,159,230,173,140,230,137,139,228,191,157,233,153,169,232,
-175,190,231,168,139,229,140,187,231,150,151,231,187,143,232,191,135,232,191,135,
-229,142,187,228,185,139,229,137,141,230,148,182,229,133,165,229,185,180,229,186,
-166,230,157,130,229,191,151,231,190,142,228,184,189,230,156,128,233,171,152,231,
-153,187,233,153,134,230,156,170,230,157,165,229,138,160,229,183,165,229,133,141,
-232,180,163,230,149,153,231,168,139,231,137,136,229,157,151,232,186,171,228,189,
-147,233,135,141,229,186,134,229,135,186,229,148,174,230,136,144,230,156,172,229,
-189,162,229,188,143,229,156,159,232,177,134,229,135,186,229,131,185,228,184,156,
-230,150,185,233,130,174,231,174,177,229,141,151,228,186,172,230,177,130,232,129,
-140,229,143,150,229,190,151,232,129,140,228,189,141,231,155,184,228,191,161,233,
-161,181,233,157,162,229,136,134,233,146,159,231,189,145,233,161,181,231,161,174,
-229,174,154,229,155,190,228,190,139,231,189,145,229,157,128,231,167,175,230,158,
-129,233,148,153,232,175,175,231,155,174,231,154,132,229,174,157,232,180,157,230,
-156,186,229,133,179,233,163,142,233,153,169,230,142,136,230,157,131,231,151,133,
-230,175,146,229,174,160,231,137,169,233,153,164,228,186,134,232,169,149,232,171,
-150,231,150,190,231,151,133,229,143,138,230,151,182,230,177,130,232,180,173,231,
-171,153,231,130,185,229,132,191,231,171,165,230,175,143,229,164,169,228,184,173,
-229,164,174,232,174,164,232,175,134,230,175,143,228,184,170,229,164,169,230,180,
-165,229,173,151,228,189,147,229,143,176,231,129,163,231,187,180,230,138,164,230,
-156,172,233,161,181,228,184,170,230,128,167,229,174,152,230,150,185,229,184,184,
-232,167,129,231,155,184,230,156,186,230,136,152,231,149,165,229,186,148,229,189,
-147,229,190,139,229,184,136,230,150,185,228,190,191,230,160,161,229,155,173,232,
-130,161,229,184,130,230,136,191,229,177,139,230,160,143,231,155,174,229,145,152,
-229,183,165,229,175,188,232,135,180,231,170,129,231,132,182,233,129,147,229,133,
-183,230,156,172,231,189,145,231,187,147,229,144,136,230,161,163,230,161,136,229,
-138,179,229,138,168,229,143,166,229,164,150,231,190,142,229,133,131,229,188,149,
-232,181,183,230,148,185,229,143,152,231,172,172,229,155,155,228,188,154,232,174,
-161,232,170,170,230,152,142,233,154,144,231,167,129,229,174,157,229,174,157,232,
-167,132,232,140,131,230,182,136,232,180,185,229,133,177,229,144,140,229,191,152,
-232,174,176,228,189,147,231,179,187,229,184,166,230,157,165,229,144,141,229,173,
-151,231,153,188,232,161,168,229,188,128,230,148,190,229,138,160,231,155,159,229,
-143,151,229,136,176,228,186,140,230,137,139,229,164,167,233,135,143,230,136,144,
-228,186,186,230,149,176,233,135,143,229,133,177,228,186,171,229,140,186,229,159,
-159,229,165,179,229,173,169,229,142,159,229,136,153,230,137,128,229,156,168,231,
-187,147,230,157,159,233,128,154,228,191,161,232,182,133,231,186,167,233,133,141,
-231,189,174,229,189,147,230,151,182,228,188,152,231,167,128,230,128,167,230,132,
-159,230,136,191,228,186,167,233,129,138,230,136,178,229,135,186,229,143,163,230,
-143,144,228,186,164,229,176,177,228,184,154,228,191,157,229,129,165,231,168,139,
-229,186,166,229,143,130,230,149,176,228,186,139,228,184,154,230,149,180,228,184,
-170,229,177,177,228,184,156,230,131,133,230,132,159,231,137,185,230,174,138,229,
-136,134,233,161,158,230,144,156,229,176,139,229,177,158,228,186,142,233,151,168,
-230,136,183,232,180,162,229,138,161,229,163,176,233,159,179,229,143,138,229,133,
-182,232,180,162,231,187,143,229,157,154,230,140,129,229,185,178,233,131,168,230,
-136,144,231,171,139,229,136,169,231,155,138,232,128,131,232,153,145,230,136,144,
-233,131,189,229,140,133,232,163,133,231,148,168,230,136,182,230,175,148,232,181,
-155,230,150,135,230,152,142,230,139,155,229,149,134,229,174,140,230,149,180,231,
-156,159,230,152,175,231,156,188,231,157,155,228,188,153,228,188,180,229,168,129,
-230,156,155,233,162,134,229,159,159,229,141,171,231,148,159,228,188,152,230,131,
-160,232,171,150,229,163,135,229,133,172,229,133,177,232,137,175,229,165,189,229,
-133,133,229,136,134,231,172,166,229,144,136,233,153,132,228,187,182,231,137,185,
-231,130,185,228,184,141,229,143,175,232,139,177,230,150,135,232,181,132,228,186,
-167,230,160,185,230,156,172,230,152,142,230,152,190,229,175,134,231,162,188,229,
-133,172,228,188,151,230,176,145,230,151,143,230,155,180,229,138,160,228,186,171,
-229,143,151,229,144,140,229,173,166,229,144,175,229,138,168,233,128,130,229,144,
-136,229,142,159,230,157,165,233,151,174,231,173,148,230,156,172,230,150,135,231,
-190,142,233,163,159,231,187,191,232,137,178,231,168,179,229,174,154,231,187,136,
-228,186,142,231,148,159,231,137,169,228,190,155,230,177,130,230,144,156,231,139,
-144,229,138,155,233,135,143,228,184,165,233,135,141,230,176,184,232,191,156,229,
-134,153,231,156,159,230,156,137,233,153,144,231,171,158,228,186,137,229,175,185,
-232,177,161,232,180,185,231,148,168,228,184,141,229,165,189,231,187,157,229,175,
-185,229,141,129,229,136,134,228,191,131,232,191,155,231,130,185,232,175,132,229,
-189,177,233,159,179,228,188,152,229,138,191,228,184,141,229,176,145,230,172,163,
-232,181,143,229,185,182,228,184,148,230,156,137,231,130,185,230,150,185,229,144,
-145,229,133,168,230,150,176,228,191,161,231,148,168,232,174,190,230,150,189,229,
-189,162,232,177,161,232,181,132,230,160,188,231,170,129,231,160,180,233,154,143,
-231,157,128,233,135,141,229,164,167,228,186,142,230,152,175,230,175,149,228,184,
-154,230,153,186,232,131,189,229,140,150,229,183,165,229,174,140,231,190,142,229,
-149,134,229,159,142,231,187,159,228,184,128,229,135,186,231,137,136,230,137,147,
-233,128,160,231,148,162,229,147,129,230,166,130,229,134,181,231,148,168,228,186,
-142,228,191,157,231,149,153,229,155,160,231,180,160,228,184,173,229,156,139,229,
-173,152,229,130,168,232,180,180,229,155,190,230,156,128,230,132,155,233,149,191,
-230,156,159,229,143,163,228,187,183,231,144,134,232,180,162,229,159,186,229,156,
-176,229,174,137,230,142,146,230,173,166,230,177,137,233,135,140,233,157,162,229,
-136,155,229,187,186,229,164,169,231,169,186,233,166,150,229,133,136,229,174,140,
-229,150,132,233,169,177,229,138,168,228,184,139,233,157,162,228,184,141,229,134,
-141,232,175,154,228,191,161,230,132,143,228,185,137,233,152,179,229,133,137,232,
-139,177,229,155,189,230,188,130,228,186,174,229,134,155,228,186,139,231,142,169,
-229,174,182,231,190,164,228,188,151,229,134,156,230,176,145,229,141,179,229,143,
-175,229,144,141,231,168,177,229,174,182,229,133,183,229,138,168,231,148,187,230,
-131,179,229,136,176,230,179,168,230,152,142,229,176,143,229,173,166,230,128,167,
-232,131,189,232,128,131,231,160,148,231,161,172,228,187,182,232,167,130,231,156,
-139,230,184,133,230,165,154,230,144,158,231,172,145,233,166,150,233,160,129,233,
-187,132,233,135,145,233,128,130,231,148,168,230,177,159,232,139,143,231,156,159,
-229,174,158,228,184,187,231,174,161,233,152,182,230,174,181,232,168,187,229,134,
-138,231,191,187,232,175,145,230,157,131,229,136,169,229,129,154,229,165,189,228,
-188,188,228,185,142,233,128,154,232,174,175,230,150,189,229,183,165,231,139,128,
-230,133,139,228,185,159,232,174,184,231,142,175,228,191,157,229,159,185,229,133,
-187,230,166,130,229,191,181,229,164,167,229,158,139,230,156,186,231,165,168,231,
-144,134,232,167,163,229,140,191,229,144,141,99,117,97,110,100,111,101,110,118,
-105,97,114,109,97,100,114,105,100,98,117,115,99,97,114,105,110,105,99,105,111,
-116,105,101,109,112,111,112,111,114,113,117,101,99,117,101,110,116,97,101,115,
-116,97,100,111,112,117,101,100,101,110,106,117,101,103,111,115,99,111,110,116,
-114,97,101,115,116,195,161,110,110,111,109,98,114,101,116,105,101,110,101,110,
-112,101,114,102,105,108,109,97,110,101,114,97,97,109,105,103,111,115,99,105,117,
-100,97,100,99,101,110,116,114,111,97,117,110,113,117,101,112,117,101,100,101,115
-,100,101,110,116,114,111,112,114,105,109,101,114,112,114,101,99,105,111,115,101,
-103,195,186,110,98,117,101,110,111,115,118,111,108,118,101,114,112,117,110,116,
-111,115,115,101,109,97,110,97,104,97,98,195,173,97,97,103,111,115,116,111,110,
-117,101,118,111,115,117,110,105,100,111,115,99,97,114,108,111,115,101,113,117,
-105,112,111,110,105,195,177,111,115,109,117,99,104,111,115,97,108,103,117,110,97
-,99,111,114,114,101,111,105,109,97,103,101,110,112,97,114,116,105,114,97,114,114
-,105,98,97,109,97,114,195,173,97,104,111,109,98,114,101,101,109,112,108,101,111,
-118,101,114,100,97,100,99,97,109,98,105,111,109,117,99,104,97,115,102,117,101,
-114,111,110,112,97,115,97,100,111,108,195,173,110,101,97,112,97,114,101,99,101,
-110,117,101,118,97,115,99,117,114,115,111,115,101,115,116,97,98,97,113,117,105,
-101,114,111,108,105,98,114,111,115,99,117,97,110,116,111,97,99,99,101,115,111,
-109,105,103,117,101,108,118,97,114,105,111,115,99,117,97,116,114,111,116,105,101
-,110,101,115,103,114,117,112,111,115,115,101,114,195,161,110,101,117,114,111,112
-,97,109,101,100,105,111,115,102,114,101,110,116,101,97,99,101,114,99,97,100,101,
-109,195,161,115,111,102,101,114,116,97,99,111,99,104,101,115,109,111,100,101,108
-,111,105,116,97,108,105,97,108,101,116,114,97,115,97,108,103,195,186,110,99,111,
-109,112,114,97,99,117,97,108,101,115,101,120,105,115,116,101,99,117,101,114,112,
-111,115,105,101,110,100,111,112,114,101,110,115,97,108,108,101,103,97,114,118,
-105,97,106,101,115,100,105,110,101,114,111,109,117,114,99,105,97,112,111,100,114
-,195,161,112,117,101,115,116,111,100,105,97,114,105,111,112,117,101,98,108,111,
-113,117,105,101,114,101,109,97,110,117,101,108,112,114,111,112,105,111,99,114,
-105,115,105,115,99,105,101,114,116,111,115,101,103,117,114,111,109,117,101,114,
-116,101,102,117,101,110,116,101,99,101,114,114,97,114,103,114,97,110,100,101,101
-,102,101,99,116,111,112,97,114,116,101,115,109,101,100,105,100,97,112,114,111,
-112,105,97,111,102,114,101,99,101,116,105,101,114,114,97,101,45,109,97,105,108,
-118,97,114,105,97,115,102,111,114,109,97,115,102,117,116,117,114,111,111,98,106,
-101,116,111,115,101,103,117,105,114,114,105,101,115,103,111,110,111,114,109,97,
-115,109,105,115,109,111,115,195,186,110,105,99,111,99,97,109,105,110,111,115,105
-,116,105,111,115,114,97,122,195,179,110,100,101,98,105,100,111,112,114,117,101,
-98,97,116,111,108,101,100,111,116,101,110,195,173,97,106,101,115,195,186,115,101
-,115,112,101,114,111,99,111,99,105,110,97,111,114,105,103,101,110,116,105,101,
-110,100,97,99,105,101,110,116,111,99,195,161,100,105,122,104,97,98,108,97,114,
-115,101,114,195,173,97,108,97,116,105,110,97,102,117,101,114,122,97,101,115,116,
-105,108,111,103,117,101,114,114,97,101,110,116,114,97,114,195,169,120,105,116,
-111,108,195,179,112,101,122,97,103,101,110,100,97,118,195,173,100,101,111,101,
-118,105,116,97,114,112,97,103,105,110,97,109,101,116,114,111,115,106,97,118,105,
-101,114,112,97,100,114,101,115,102,195,161,99,105,108,99,97,98,101,122,97,195,
-161,114,101,97,115,115,97,108,105,100,97,101,110,118,195,173,111,106,97,112,195,
-179,110,97,98,117,115,111,115,98,105,101,110,101,115,116,101,120,116,111,115,108
-,108,101,118,97,114,112,117,101,100,97,110,102,117,101,114,116,101,99,111,109,
-195,186,110,99,108,97,115,101,115,104,117,109,97,110,111,116,101,110,105,100,111
-,98,105,108,98,97,111,117,110,105,100,97,100,101,115,116,195,161,115,101,100,105
-,116,97,114,99,114,101,97,100,111,208,180,208,187,209,143,209,135,209,130,208,
-190,208,186,208,176,208,186,208,184,208,187,208,184,209,141,209,130,208,190,208,
-178,209,129,208,181,208,181,208,179,208,190,208,191,209,128,208,184,209,130,208,
-176,208,186,208,181,209,137,208,181,209,131,208,182,208,181,208,154,208,176,208,
-186,208,177,208,181,208,183,208,177,209,139,208,187,208,190,208,189,208,184,208,
-146,209,129,208,181,208,191,208,190,208,180,208,173,209,130,208,190,209,130,208,
-190,208,188,209,135,208,181,208,188,208,189,208,181,209,130,208,187,208,181,209,
-130,209,128,208,176,208,183,208,190,208,189,208,176,208,179,208,180,208,181,208,
-188,208,189,208,181,208,148,208,187,209,143,208,159,209,128,208,184,208,189,208,
-176,209,129,208,189,208,184,209,133,209,130,208,181,208,188,208,186,209,130,208,
-190,208,179,208,190,208,180,208,178,208,190,209,130,209,130,208,176,208,188,208,
-161,208,168,208,144,208,188,208,176,209,143,208,167,209,130,208,190,208,178,208,
-176,209,129,208,178,208,176,208,188,208,181,208,188,209,131,208,162,208,176,208,
-186,208,180,208,178,208,176,208,189,208,176,208,188,209,141,209,130,208,184,209,
-141,209,130,209,131,208,146,208,176,208,188,209,130,208,181,209,133,208,191,209,
-128,208,190,209,130,209,131,209,130,208,189,208,176,208,180,208,180,208,189,209,
-143,208,146,208,190,209,130,209,130,209,128,208,184,208,189,208,181,208,185,208,
-146,208,176,209,129,208,189,208,184,208,188,209,129,208,176,208,188,209,130,208,
-190,209,130,209,128,209,131,208,177,208,158,208,189,208,184,208,188,208,184,209,
-128,208,189,208,181,208,181,208,158,208,158,208,158,208,187,208,184,209,134,209,
-141,209,130,208,176,208,158,208,189,208,176,208,189,208,181,208,188,208,180,208,
-190,208,188,208,188,208,190,208,185,208,180,208,178,208,181,208,190,208,189,208,
-190,209,129,209,131,208,180,224,164,149,224,165,135,224,164,185,224,165,136,224,
-164,149,224,165,128,224,164,184,224,165,135,224,164,149,224,164,190,224,164,149,
-224,165,139,224,164,148,224,164,176,224,164,170,224,164,176,224,164,168,224,165,
-135,224,164,143,224,164,149,224,164,149,224,164,191,224,164,173,224,165,128,224,
-164,135,224,164,184,224,164,149,224,164,176,224,164,164,224,165,139,224,164,185,
-224,165,139,224,164,134,224,164,170,224,164,185,224,165,128,224,164,175,224,164,
-185,224,164,175,224,164,190,224,164,164,224,164,149,224,164,165,224,164,190,106,
-97,103,114,97,110,224,164,134,224,164,156,224,164,156,224,165,139,224,164,133,
-224,164,172,224,164,166,224,165,139,224,164,151,224,164,136,224,164,156,224,164,
-190,224,164,151,224,164,143,224,164,185,224,164,174,224,164,135,224,164,168,224,
-164,181,224,164,185,224,164,175,224,165,135,224,164,165,224,165,135,224,164,165,
-224,165,128,224,164,152,224,164,176,224,164,156,224,164,172,224,164,166,224,165,
-128,224,164,149,224,164,136,224,164,156,224,165,128,224,164,181,224,165,135,224,
-164,168,224,164,136,224,164,168,224,164,143,224,164,185,224,164,176,224,164,137,
-224,164,184,224,164,174,224,165,135,224,164,149,224,164,174,224,164,181,224,165,
-139,224,164,178,224,165,135,224,164,184,224,164,172,224,164,174,224,164,136,224,
-164,166,224,165,135,224,164,147,224,164,176,224,164,134,224,164,174,224,164,172,
-224,164,184,224,164,173,224,164,176,224,164,172,224,164,168,224,164,154,224,164,
-178,224,164,174,224,164,168,224,164,134,224,164,151,224,164,184,224,165,128,224,
-164,178,224,165,128,216,185,217,132,217,137,216,165,217,132,217,137,217,135,216,
-176,216,167,216,162,216,174,216,177,216,185,216,175,216,175,216,167,217,132,217,
-137,217,135,216,176,217,135,216,181,217,136,216,177,216,186,217,138,216,177,217,
-131,216,167,217,134,217,136,217,132,216,167,216,168,217,138,217,134,216,185,216,
-177,216,182,216,176,217,132,217,131,217,135,217,134,216,167,217,138,217,136,217,
-133,217,130,216,167,217,132,216,185,217,132,217,138,216,167,217,134,216,167,217,
-132,217,131,217,134,216,173,216,170,217,137,217,130,216,168,217,132,217,136,216,
-173,216,169,216,167,216,174,216,177,217,129,217,130,216,183,216,185,216,168,216,
-175,216,177,217,131,217,134,216,165,216,176,216,167,217,131,217,133,216,167,216,
-167,216,173,216,175,216,165,217,132,216,167,217,129,217,138,217,135,216,168,216,
-185,216,182,217,131,217,138,217,129,216,168,216,173,216,171,217,136,217,133,217,
-134,217,136,217,135,217,136,216,163,217,134,216,167,216,172,216,175,216,167,217,
-132,217,135,216,167,216,179,217,132,217,133,216,185,217,134,216,175,217,132,217,
-138,216,179,216,185,216,168,216,177,216,181,217,132,217,137,217,133,217,134,216,
-176,216,168,217,135,216,167,216,163,217,134,217,135,217,133,216,171,217,132,217,
-131,217,134,216,170,216,167,217,132,216,167,216,173,217,138,216,171,217,133,216,
-181,216,177,216,180,216,177,216,173,216,173,217,136,217,132,217,136,217,129,217,
-138,216,167,216,176,216,167,217,132,217,131,217,132,217,133,216,177,216,169,216,
-167,217,134,216,170,216,167,217,132,217,129,216,163,216,168,217,136,216,174,216,
-167,216,181,216,163,217,134,216,170,216,167,217,134,217,135,216,167,217,132,217,
-138,216,185,216,182,217,136,217,136,217,130,216,175,216,167,216,168,217,134,216,
-174,217,138,216,177,216,168,217,134,216,170,217,132,217,131,217,133,216,180,216,
-167,216,161,217,136,217,135,217,138,216,167,216,168,217,136,217,130,216,181,216,
-181,217,136,217,133,216,167,216,177,217,130,217,133,216,163,216,173,216,175,217,
-134,216,173,217,134,216,185,216,175,217,133,216,177,216,163,217,138,216,167,216,
-173,216,169,217,131,216,170,216,168,216,175,217,136,217,134,217,138,216,172,216,
-168,217,133,217,134,217,135,216,170,216,173,216,170,216,172,217,135,216,169,216,
-179,217,134,216,169,217,138,216,170,217,133,217,131,216,177,216,169,216,186,216,
-178,216,169,217,134,217,129,216,179,216,168,217,138,216,170,217,132,217,132,217,
-135,217,132,217,134,216,167,216,170,217,132,217,131,217,130,217,132,216,168,217,
-132,217,133,216,167,216,185,217,134,217,135,216,163,217,136,217,132,216,180,217,
-138,216,161,217,134,217,136,216,177,216,163,217,133,216,167,217,129,217,138,217,
-131,216,168,217,131,217,132,216,176,216,167,216,170,216,177,216,170,216,168,216,
-168,216,163,217,134,217,135,217,133,216,179,216,167,217,134,217,131,216,168,217,
-138,216,185,217,129,217,130,216,175,216,173,216,179,217,134,217,132,217,135,217,
-133,216,180,216,185,216,177,216,163,217,135,217,132,216,180,217,135,216,177,217,
-130,216,183,216,177,216,183,217,132,216,168,112,114,111,102,105,108,101,115,101,
-114,118,105,99,101,100,101,102,97,117,108,116,104,105,109,115,101,108,102,100,
-101,116,97,105,108,115,99,111,110,116,101,110,116,115,117,112,112,111,114,116,
-115,116,97,114,116,101,100,109,101,115,115,97,103,101,115,117,99,99,101,115,115,
-102,97,115,104,105,111,110,60,116,105,116,108,101,62,99,111,117,110,116,114,121,
-97,99,99,111,117,110,116,99,114,101,97,116,101,100,115,116,111,114,105,101,115,
-114,101,115,117,108,116,115,114,117,110,110,105,110,103,112,114,111,99,101,115,
-115,119,114,105,116,105,110,103,111,98,106,101,99,116,115,118,105,115,105,98,108
-,101,119,101,108,99,111,109,101,97,114,116,105,99,108,101,117,110,107,110,111,
-119,110,110,101,116,119,111,114,107,99,111,109,112,97,110,121,100,121,110,97,109
-,105,99,98,114,111,119,115,101,114,112,114,105,118,97,99,121,112,114,111,98,108,
-101,109,83,101,114,118,105,99,101,114,101,115,112,101,99,116,100,105,115,112,108
-,97,121,114,101,113,117,101,115,116,114,101,115,101,114,118,101,119,101,98,115,
-105,116,101,104,105,115,116,111,114,121,102,114,105,101,110,100,115,111,112,116,
-105,111,110,115,119,111,114,107,105,110,103,118,101,114,115,105,111,110,109,105,
-108,108,105,111,110,99,104,97,110,110,101,108,119,105,110,100,111,119,46,97,100,
-100,114,101,115,115,118,105,115,105,116,101,100,119,101,97,116,104,101,114,99,
-111,114,114,101,99,116,112,114,111,100,117,99,116,101,100,105,114,101,99,116,102
-,111,114,119,97,114,100,121,111,117,32,99,97,110,114,101,109,111,118,101,100,115
-,117,98,106,101,99,116,99,111,110,116,114,111,108,97,114,99,104,105,118,101,99,
-117,114,114,101,110,116,114,101,97,100,105,110,103,108,105,98,114,97,114,121,108
-,105,109,105,116,101,100,109,97,110,97,103,101,114,102,117,114,116,104,101,114,
-115,117,109,109,97,114,121,109,97,99,104,105,110,101,109,105,110,117,116,101,115
-,112,114,105,118,97,116,101,99,111,110,116,101,120,116,112,114,111,103,114,97,
-109,115,111,99,105,101,116,121,110,117,109,98,101,114,115,119,114,105,116,116,
-101,110,101,110,97,98,108,101,100,116,114,105,103,103,101,114,115,111,117,114,99
-,101,115,108,111,97,100,105,110,103,101,108,101,109,101,110,116,112,97,114,116,
-110,101,114,102,105,110,97,108,108,121,112,101,114,102,101,99,116,109,101,97,110
-,105,110,103,115,121,115,116,101,109,115,107,101,101,112,105,110,103,99,117,108,
-116,117,114,101,38,113,117,111,116,59,44,106,111,117,114,110,97,108,112,114,111,
-106,101,99,116,115,117,114,102,97,99,101,115,38,113,117,111,116,59,101,120,112,
-105,114,101,115,114,101,118,105,101,119,115,98,97,108,97,110,99,101,69,110,103,
-108,105,115,104,67,111,110,116,101,110,116,116,104,114,111,117,103,104,80,108,
-101,97,115,101,32,111,112,105,110,105,111,110,99,111,110,116,97,99,116,97,118,
-101,114,97,103,101,112,114,105,109,97,114,121,118,105,108,108,97,103,101,83,112,
-97,110,105,115,104,103,97,108,108,101,114,121,100,101,99,108,105,110,101,109,101
-,101,116,105,110,103,109,105,115,115,105,111,110,112,111,112,117,108,97,114,113,
-117,97,108,105,116,121,109,101,97,115,117,114,101,103,101,110,101,114,97,108,115
-,112,101,99,105,101,115,115,101,115,115,105,111,110,115,101,99,116,105,111,110,
-119,114,105,116,101,114,115,99,111,117,110,116,101,114,105,110,105,116,105,97,
-108,114,101,112,111,114,116,115,102,105,103,117,114,101,115,109,101,109,98,101,
-114,115,104,111,108,100,105,110,103,100,105,115,112,117,116,101,101,97,114,108,
-105,101,114,101,120,112,114,101,115,115,100,105,103,105,116,97,108,112,105,99,
-116,117,114,101,65,110,111,116,104,101,114,109,97,114,114,105,101,100,116,114,97
-,102,102,105,99,108,101,97,100,105,110,103,99,104,97,110,103,101,100,99,101,110,
-116,114,97,108,118,105,99,116,111,114,121,105,109,97,103,101,115,47,114,101,97,
-115,111,110,115,115,116,117,100,105,101,115,102,101,97,116,117,114,101,108,105,
-115,116,105,110,103,109,117,115,116,32,98,101,115,99,104,111,111,108,115,86,101,
-114,115,105,111,110,117,115,117,97,108,108,121,101,112,105,115,111,100,101,112,
-108,97,121,105,110,103,103,114,111,119,105,110,103,111,98,118,105,111,117,115,
-111,118,101,114,108,97,121,112,114,101,115,101,110,116,97,99,116,105,111,110,115
-,60,47,117,108,62,13,10,119,114,97,112,112,101,114,97,108,114,101,97,100,121,99,
-101,114,116,97,105,110,114,101,97,108,105,116,121,115,116,111,114,97,103,101,97,
-110,111,116,104,101,114,100,101,115,107,116,111,112,111,102,102,101,114,101,100,
-112,97,116,116,101,114,110,117,110,117,115,117,97,108,68,105,103,105,116,97,108,
-99,97,112,105,116,97,108,87,101,98,115,105,116,101,102,97,105,108,117,114,101,99
-,111,110,110,101,99,116,114,101,100,117,99,101,100,65,110,100,114,111,105,100,
-100,101,99,97,100,101,115,114,101,103,117,108,97,114,32,38,97,109,112,59,32,97,
-110,105,109,97,108,115,114,101,108,101,97,115,101,65,117,116,111,109,97,116,103,
-101,116,116,105,110,103,109,101,116,104,111,100,115,110,111,116,104,105,110,103,
-80,111,112,117,108,97,114,99,97,112,116,105,111,110,108,101,116,116,101,114,115,
-99,97,112,116,117,114,101,115,99,105,101,110,99,101,108,105,99,101,110,115,101,
-99,104,97,110,103,101,115,69,110,103,108,97,110,100,61,49,38,97,109,112,59,72,
-105,115,116,111,114,121,32,61,32,110,101,119,32,67,101,110,116,114,97,108,117,
-112,100,97,116,101,100,83,112,101,99,105,97,108,78,101,116,119,111,114,107,114,
-101,113,117,105,114,101,99,111,109,109,101,110,116,119,97,114,110,105,110,103,67
-,111,108,108,101,103,101,116,111,111,108,98,97,114,114,101,109,97,105,110,115,98
-,101,99,97,117,115,101,101,108,101,99,116,101,100,68,101,117,116,115,99,104,102,
-105,110,97,110,99,101,119,111,114,107,101,114,115,113,117,105,99,107,108,121,98,
-101,116,119,101,101,110,101,120,97,99,116,108,121,115,101,116,116,105,110,103,
-100,105,115,101,97,115,101,83,111,99,105,101,116,121,119,101,97,112,111,110,115,
-101,120,104,105,98,105,116,38,108,116,59,33,45,45,67,111,110,116,114,111,108,99,
-108,97,115,115,101,115,99,111,118,101,114,101,100,111,117,116,108,105,110,101,97
-,116,116,97,99,107,115,100,101,118,105,99,101,115,40,119,105,110,100,111,119,112
-,117,114,112,111,115,101,116,105,116,108,101,61,34,77,111,98,105,108,101,32,107,
-105,108,108,105,110,103,115,104,111,119,105,110,103,73,116,97,108,105,97,110,100
-,114,111,112,112,101,100,104,101,97,118,105,108,121,101,102,102,101,99,116,115,
-45,49,39,93,41,59,10,99,111,110,102,105,114,109,67,117,114,114,101,110,116,97,
-100,118,97,110,99,101,115,104,97,114,105,110,103,111,112,101,110,105,110,103,100
-,114,97,119,105,110,103,98,105,108,108,105,111,110,111,114,100,101,114,101,100,
-71,101,114,109,97,110,121,114,101,108,97,116,101,100,60,47,102,111,114,109,62,
-105,110,99,108,117,100,101,119,104,101,116,104,101,114,100,101,102,105,110,101,
-100,83,99,105,101,110,99,101,99,97,116,97,108,111,103,65,114,116,105,99,108,101,
-98,117,116,116,111,110,115,108,97,114,103,101,115,116,117,110,105,102,111,114,
-109,106,111,117,114,110,101,121,115,105,100,101,98,97,114,67,104,105,99,97,103,
-111,104,111,108,105,100,97,121,71,101,110,101,114,97,108,112,97,115,115,97,103,
-101,44,38,113,117,111,116,59,97,110,105,109,97,116,101,102,101,101,108,105,110,
-103,97,114,114,105,118,101,100,112,97,115,115,105,110,103,110,97,116,117,114,97,
-108,114,111,117,103,104,108,121,46,10,10,84,104,101,32,98,117,116,32,110,111,116
-,100,101,110,115,105,116,121,66,114,105,116,97,105,110,67,104,105,110,101,115,
-101,108,97,99,107,32,111,102,116,114,105,98,117,116,101,73,114,101,108,97,110,
-100,34,32,100,97,116,97,45,102,97,99,116,111,114,115,114,101,99,101,105,118,101,
-116,104,97,116,32,105,115,76,105,98,114,97,114,121,104,117,115,98,97,110,100,105
-,110,32,102,97,99,116,97,102,102,97,105,114,115,67,104,97,114,108,101,115,114,97
-,100,105,99,97,108,98,114,111,117,103,104,116,102,105,110,100,105,110,103,108,97
-,110,100,105,110,103,58,108,97,110,103,61,34,114,101,116,117,114,110,32,108,101,
-97,100,101,114,115,112,108,97,110,110,101,100,112,114,101,109,105,117,109,112,97
-,99,107,97,103,101,65,109,101,114,105,99,97,69,100,105,116,105,111,110,93,38,113
-,117,111,116,59,77,101,115,115,97,103,101,110,101,101,100,32,116,111,118,97,108,
-117,101,61,34,99,111,109,112,108,101,120,108,111,111,107,105,110,103,115,116,97,
-116,105,111,110,98,101,108,105,101,118,101,115,109,97,108,108,101,114,45,109,111
-,98,105,108,101,114,101,99,111,114,100,115,119,97,110,116,32,116,111,107,105,110
-,100,32,111,102,70,105,114,101,102,111,120,121,111,117,32,97,114,101,115,105,109
-,105,108,97,114,115,116,117,100,105,101,100,109,97,120,105,109,117,109,104,101,
-97,100,105,110,103,114,97,112,105,100,108,121,99,108,105,109,97,116,101,107,105,
-110,103,100,111,109,101,109,101,114,103,101,100,97,109,111,117,110,116,115,102,
-111,117,110,100,101,100,112,105,111,110,101,101,114,102,111,114,109,117,108,97,
-100,121,110,97,115,116,121,104,111,119,32,116,111,32,83,117,112,112,111,114,116,
-114,101,118,101,110,117,101,101,99,111,110,111,109,121,82,101,115,117,108,116,
-115,98,114,111,116,104,101,114,115,111,108,100,105,101,114,108,97,114,103,101,
-108,121,99,97,108,108,105,110,103,46,38,113,117,111,116,59,65,99,99,111,117,110,
-116,69,100,119,97,114,100,32,115,101,103,109,101,110,116,82,111,98,101,114,116,
-32,101,102,102,111,114,116,115,80,97,99,105,102,105,99,108,101,97,114,110,101,
-100,117,112,32,119,105,116,104,104,101,105,103,104,116,58,119,101,32,104,97,118,
-101,65,110,103,101,108,101,115,110,97,116,105,111,110,115,95,115,101,97,114,99,
-104,97,112,112,108,105,101,100,97,99,113,117,105,114,101,109,97,115,115,105,118,
-101,103,114,97,110,116,101,100,58,32,102,97,108,115,101,116,114,101,97,116,101,
-100,98,105,103,103,101,115,116,98,101,110,101,102,105,116,100,114,105,118,105,
-110,103,83,116,117,100,105,101,115,109,105,110,105,109,117,109,112,101,114,104,
-97,112,115,109,111,114,110,105,110,103,115,101,108,108,105,110,103,105,115,32,
-117,115,101,100,114,101,118,101,114,115,101,118,97,114,105,97,110,116,32,114,111
-,108,101,61,34,109,105,115,115,105,110,103,97,99,104,105,101,118,101,112,114,111
-,109,111,116,101,115,116,117,100,101,110,116,115,111,109,101,111,110,101,101,120
-,116,114,101,109,101,114,101,115,116,111,114,101,98,111,116,116,111,109,58,101,
-118,111,108,118,101,100,97,108,108,32,116,104,101,115,105,116,101,109,97,112,101
-,110,103,108,105,115,104,119,97,121,32,116,111,32,32,65,117,103,117,115,116,115,
-121,109,98,111,108,115,67,111,109,112,97,110,121,109,97,116,116,101,114,115,109,
-117,115,105,99,97,108,97,103,97,105,110,115,116,115,101,114,118,105,110,103,125,
-41,40,41,59,13,10,112,97,121,109,101,110,116,116,114,111,117,98,108,101,99,111,
-110,99,101,112,116,99,111,109,112,97,114,101,112,97,114,101,110,116,115,112,108,
-97,121,101,114,115,114,101,103,105,111,110,115,109,111,110,105,116,111,114,32,39
-,39,84,104,101,32,119,105,110,110,105,110,103,101,120,112,108,111,114,101,97,100
-,97,112,116,101,100,71,97,108,108,101,114,121,112,114,111,100,117,99,101,97,98,
-105,108,105,116,121,101,110,104,97,110,99,101,99,97,114,101,101,114,115,41,46,32
-,84,104,101,32,99,111,108,108,101,99,116,83,101,97,114,99,104,32,97,110,99,105,
-101,110,116,101,120,105,115,116,101,100,102,111,111,116,101,114,32,104,97,110,
-100,108,101,114,112,114,105,110,116,101,100,99,111,110,115,111,108,101,69,97,115
-,116,101,114,110,101,120,112,111,114,116,115,119,105,110,100,111,119,115,67,104,
-97,110,110,101,108,105,108,108,101,103,97,108,110,101,117,116,114,97,108,115,117
-,103,103,101,115,116,95,104,101,97,100,101,114,115,105,103,110,105,110,103,46,
-104,116,109,108,34,62,115,101,116,116,108,101,100,119,101,115,116,101,114,110,99
-,97,117,115,105,110,103,45,119,101,98,107,105,116,99,108,97,105,109,101,100,74,
-117,115,116,105,99,101,99,104,97,112,116,101,114,118,105,99,116,105,109,115,84,
-104,111,109,97,115,32,109,111,122,105,108,108,97,112,114,111,109,105,115,101,112
-,97,114,116,105,101,115,101,100,105,116,105,111,110,111,117,116,115,105,100,101,
-58,102,97,108,115,101,44,104,117,110,100,114,101,100,79,108,121,109,112,105,99,
-95,98,117,116,116,111,110,97,117,116,104,111,114,115,114,101,97,99,104,101,100,
-99,104,114,111,110,105,99,100,101,109,97,110,100,115,115,101,99,111,110,100,115,
-112,114,111,116,101,99,116,97,100,111,112,116,101,100,112,114,101,112,97,114,101
-,110,101,105,116,104,101,114,103,114,101,97,116,108,121,103,114,101,97,116,101,
-114,111,118,101,114,97,108,108,105,109,112,114,111,118,101,99,111,109,109,97,110
-,100,115,112,101,99,105,97,108,115,101,97,114,99,104,46,119,111,114,115,104,105,
-112,102,117,110,100,105,110,103,116,104,111,117,103,104,116,104,105,103,104,101,
-115,116,105,110,115,116,101,97,100,117,116,105,108,105,116,121,113,117,97,114,
-116,101,114,67,117,108,116,117,114,101,116,101,115,116,105,110,103,99,108,101,97
-,114,108,121,101,120,112,111,115,101,100,66,114,111,119,115,101,114,108,105,98,
-101,114,97,108,125,32,99,97,116,99,104,80,114,111,106,101,99,116,101,120,97,109,
-112,108,101,104,105,100,101,40,41,59,70,108,111,114,105,100,97,97,110,115,119,
-101,114,115,97,108,108,111,119,101,100,69,109,112,101,114,111,114,100,101,102,
-101,110,115,101,115,101,114,105,111,117,115,102,114,101,101,100,111,109,83,101,
-118,101,114,97,108,45,98,117,116,116,111,110,70,117,114,116,104,101,114,111,117,
-116,32,111,102,32,33,61,32,110,117,108,108,116,114,97,105,110,101,100,68,101,110
-,109,97,114,107,118,111,105,100,40,48,41,47,97,108,108,46,106,115,112,114,101,
-118,101,110,116,82,101,113,117,101,115,116,83,116,101,112,104,101,110,10,10,87,
-104,101,110,32,111,98,115,101,114,118,101,60,47,104,50,62,13,10,77,111,100,101,
-114,110,32,112,114,111,118,105,100,101,34,32,97,108,116,61,34,98,111,114,100,101
-,114,115,46,10,10,70,111,114,32,10,10,77,97,110,121,32,97,114,116,105,115,116,
-115,112,111,119,101,114,101,100,112,101,114,102,111,114,109,102,105,99,116,105,
-111,110,116,121,112,101,32,111,102,109,101,100,105,99,97,108,116,105,99,107,101,
-116,115,111,112,112,111,115,101,100,67,111,117,110,99,105,108,119,105,116,110,
-101,115,115,106,117,115,116,105,99,101,71,101,111,114,103,101,32,66,101,108,103,
-105,117,109,46,46,46,60,47,97,62,116,119,105,116,116,101,114,110,111,116,97,98,
-108,121,119,97,105,116,105,110,103,119,97,114,102,97,114,101,32,79,116,104,101,
-114,32,114,97,110,107,105,110,103,112,104,114,97,115,101,115,109,101,110,116,105
-,111,110,115,117,114,118,105,118,101,115,99,104,111,108,97,114,60,47,112,62,13,
-10,32,67,111,117,110,116,114,121,105,103,110,111,114,101,100,108,111,115,115,32,
-111,102,106,117,115,116,32,97,115,71,101,111,114,103,105,97,115,116,114,97,110,
-103,101,60,104,101,97,100,62,60,115,116,111,112,112,101,100,49,39,93,41,59,13,10
-,105,115,108,97,110,100,115,110,111,116,97,98,108,101,98,111,114,100,101,114,58,
-108,105,115,116,32,111,102,99,97,114,114,105,101,100,49,48,48,44,48,48,48,60,47,
-104,51,62,10,32,115,101,118,101,114,97,108,98,101,99,111,109,101,115,115,101,108
-,101,99,116,32,119,101,100,100,105,110,103,48,48,46,104,116,109,108,109,111,110,
-97,114,99,104,111,102,102,32,116,104,101,116,101,97,99,104,101,114,104,105,103,
-104,108,121,32,98,105,111,108,111,103,121,108,105,102,101,32,111,102,111,114,32,
-101,118,101,110,114,105,115,101,32,111,102,38,114,97,113,117,111,59,112,108,117,
-115,111,110,101,104,117,110,116,105,110,103,40,116,104,111,117,103,104,68,111,
-117,103,108,97,115,106,111,105,110,105,110,103,99,105,114,99,108,101,115,70,111,
-114,32,116,104,101,65,110,99,105,101,110,116,86,105,101,116,110,97,109,118,101,
-104,105,99,108,101,115,117,99,104,32,97,115,99,114,121,115,116,97,108,118,97,108
-,117,101,32,61,87,105,110,100,111,119,115,101,110,106,111,121,101,100,97,32,115,
-109,97,108,108,97,115,115,117,109,101,100,60,97,32,105,100,61,34,102,111,114,101
-,105,103,110,32,65,108,108,32,114,105,104,111,119,32,116,104,101,68,105,115,112,
-108,97,121,114,101,116,105,114,101,100,104,111,119,101,118,101,114,104,105,100,
-100,101,110,59,98,97,116,116,108,101,115,115,101,101,107,105,110,103,99,97,98,
-105,110,101,116,119,97,115,32,110,111,116,108,111,111,107,32,97,116,99,111,110,
-100,117,99,116,103,101,116,32,116,104,101,74,97,110,117,97,114,121,104,97,112,
-112,101,110,115,116,117,114,110,105,110,103,97,58,104,111,118,101,114,79,110,108
-,105,110,101,32,70,114,101,110,99,104,32,108,97,99,107,105,110,103,116,121,112,
-105,99,97,108,101,120,116,114,97,99,116,101,110,101,109,105,101,115,101,118,101,
-110,32,105,102,103,101,110,101,114,97,116,100,101,99,105,100,101,100,97,114,101,
-32,110,111,116,47,115,101,97,114,99,104,98,101,108,105,101,102,115,45,105,109,97
-,103,101,58,108,111,99,97,116,101,100,115,116,97,116,105,99,46,108,111,103,105,
-110,34,62,99,111,110,118,101,114,116,118,105,111,108,101,110,116,101,110,116,101
-,114,101,100,102,105,114,115,116,34,62,99,105,114,99,117,105,116,70,105,110,108,
-97,110,100,99,104,101,109,105,115,116,115,104,101,32,119,97,115,49,48,112,120,59
-,34,62,97,115,32,115,117,99,104,100,105,118,105,100,101,100,60,47,115,112,97,110
-,62,119,105,108,108,32,98,101,108,105,110,101,32,111,102,97,32,103,114,101,97,
-116,109,121,115,116,101,114,121,47,105,110,100,101,120,46,102,97,108,108,105,110
-,103,100,117,101,32,116,111,32,114,97,105,108,119,97,121,99,111,108,108,101,103,
-101,109,111,110,115,116,101,114,100,101,115,99,101,110,116,105,116,32,119,105,
-116,104,110,117,99,108,101,97,114,74,101,119,105,115,104,32,112,114,111,116,101,
-115,116,66,114,105,116,105,115,104,102,108,111,119,101,114,115,112,114,101,100,
-105,99,116,114,101,102,111,114,109,115,98,117,116,116,111,110,32,119,104,111,32,
-119,97,115,108,101,99,116,117,114,101,105,110,115,116,97,110,116,115,117,105,99,
-105,100,101,103,101,110,101,114,105,99,112,101,114,105,111,100,115,109,97,114,
-107,101,116,115,83,111,99,105,97,108,32,102,105,115,104,105,110,103,99,111,109,
-98,105,110,101,103,114,97,112,104,105,99,119,105,110,110,101,114,115,60,98,114,
-32,47,62,60,98,121,32,116,104,101,32,78,97,116,117,114,97,108,80,114,105,118,97,
-99,121,99,111,111,107,105,101,115,111,117,116,99,111,109,101,114,101,115,111,108
-,118,101,83,119,101,100,105,115,104,98,114,105,101,102,108,121,80,101,114,115,
-105,97,110,115,111,32,109,117,99,104,67,101,110,116,117,114,121,100,101,112,105,
-99,116,115,99,111,108,117,109,110,115,104,111,117,115,105,110,103,115,99,114,105
-,112,116,115,110,101,120,116,32,116,111,98,101,97,114,105,110,103,109,97,112,112
-,105,110,103,114,101,118,105,115,101,100,106,81,117,101,114,121,40,45,119,105,
-100,116,104,58,116,105,116,108,101,34,62,116,111,111,108,116,105,112,83,101,99,
-116,105,111,110,100,101,115,105,103,110,115,84,117,114,107,105,115,104,121,111,
-117,110,103,101,114,46,109,97,116,99,104,40,125,41,40,41,59,10,10,98,117,114,110
-,105,110,103,111,112,101,114,97,116,101,100,101,103,114,101,101,115,115,111,117,
-114,99,101,61,82,105,99,104,97,114,100,99,108,111,115,101,108,121,112,108,97,115
-,116,105,99,101,110,116,114,105,101,115,60,47,116,114,62,13,10,99,111,108,111,
-114,58,35,117,108,32,105,100,61,34,112,111,115,115,101,115,115,114,111,108,108,
-105,110,103,112,104,121,115,105,99,115,102,97,105,108,105,110,103,101,120,101,99
-,117,116,101,99,111,110,116,101,115,116,108,105,110,107,32,116,111,68,101,102,97
-,117,108,116,60,98,114,32,47,62,10,58,32,116,114,117,101,44,99,104,97,114,116,
-101,114,116,111,117,114,105,115,109,99,108,97,115,115,105,99,112,114,111,99,101,
-101,100,101,120,112,108,97,105,110,60,47,104,49,62,13,10,111,110,108,105,110,101
-,46,63,120,109,108,32,118,101,104,101,108,112,105,110,103,100,105,97,109,111,110
-,100,117,115,101,32,116,104,101,97,105,114,108,105,110,101,101,110,100,32,45,45,
-62,41,46,97,116,116,114,40,114,101,97,100,101,114,115,104,111,115,116,105,110,
-103,35,102,102,102,102,102,102,114,101,97,108,105,122,101,86,105,110,99,101,110,
-116,115,105,103,110,97,108,115,32,115,114,99,61,34,47,80,114,111,100,117,99,116,
-100,101,115,112,105,116,101,100,105,118,101,114,115,101,116,101,108,108,105,110,
-103,80,117,98,108,105,99,32,104,101,108,100,32,105,110,74,111,115,101,112,104,32
-,116,104,101,97,116,114,101,97,102,102,101,99,116,115,60,115,116,121,108,101,62,
-97,32,108,97,114,103,101,100,111,101,115,110,39,116,108,97,116,101,114,44,32,69,
-108,101,109,101,110,116,102,97,118,105,99,111,110,99,114,101,97,116,111,114,72,
-117,110,103,97,114,121,65,105,114,112,111,114,116,115,101,101,32,116,104,101,115
-,111,32,116,104,97,116,77,105,99,104,97,101,108,83,121,115,116,101,109,115,80,
-114,111,103,114,97,109,115,44,32,97,110,100,32,32,119,105,100,116,104,61,101,38,
-113,117,111,116,59,116,114,97,100,105,110,103,108,101,102,116,34,62,10,112,101,
-114,115,111,110,115,71,111,108,100,101,110,32,65,102,102,97,105,114,115,103,114,
-97,109,109,97,114,102,111,114,109,105,110,103,100,101,115,116,114,111,121,105,
-100,101,97,32,111,102,99,97,115,101,32,111,102,111,108,100,101,115,116,32,116,
-104,105,115,32,105,115,46,115,114,99,32,61,32,99,97,114,116,111,111,110,114,101,
-103,105,115,116,114,67,111,109,109,111,110,115,77,117,115,108,105,109,115,87,104
-,97,116,32,105,115,105,110,32,109,97,110,121,109,97,114,107,105,110,103,114,101,
-118,101,97,108,115,73,110,100,101,101,100,44,101,113,117,97,108,108,121,47,115,
-104,111,119,95,97,111,117,116,100,111,111,114,101,115,99,97,112,101,40,65,117,
-115,116,114,105,97,103,101,110,101,116,105,99,115,121,115,116,101,109,44,73,110,
-32,116,104,101,32,115,105,116,116,105,110,103,72,101,32,97,108,115,111,73,115,
-108,97,110,100,115,65,99,97,100,101,109,121,10,9,9,60,33,45,45,68,97,110,105,101
-,108,32,98,105,110,100,105,110,103,98,108,111,99,107,34,62,105,109,112,111,115,
-101,100,117,116,105,108,105,122,101,65,98,114,97,104,97,109,40,101,120,99,101,
-112,116,123,119,105,100,116,104,58,112,117,116,116,105,110,103,41,46,104,116,109
-,108,40,124,124,32,91,93,59,10,68,65,84,65,91,32,42,107,105,116,99,104,101,110,
-109,111,117,110,116,101,100,97,99,116,117,97,108,32,100,105,97,108,101,99,116,
-109,97,105,110,108,121,32,95,98,108,97,110,107,39,105,110,115,116,97,108,108,101
-,120,112,101,114,116,115,105,102,40,116,121,112,101,73,116,32,97,108,115,111,38,
-99,111,112,121,59,32,34,62,84,101,114,109,115,98,111,114,110,32,105,110,79,112,
-116,105,111,110,115,101,97,115,116,101,114,110,116,97,108,107,105,110,103,99,111
-,110,99,101,114,110,103,97,105,110,101,100,32,111,110,103,111,105,110,103,106,
-117,115,116,105,102,121,99,114,105,116,105,99,115,102,97,99,116,111,114,121,105,
-116,115,32,111,119,110,97,115,115,97,117,108,116,105,110,118,105,116,101,100,108
-,97,115,116,105,110,103,104,105,115,32,111,119,110,104,114,101,102,61,34,47,34,
-32,114,101,108,61,34,100,101,118,101,108,111,112,99,111,110,99,101,114,116,100,
-105,97,103,114,97,109,100,111,108,108,97,114,115,99,108,117,115,116,101,114,112,
-104,112,63,105,100,61,97,108,99,111,104,111,108,41,59,125,41,40,41,59,117,115,
-105,110,103,32,97,62,60,115,112,97,110,62,118,101,115,115,101,108,115,114,101,
-118,105,118,97,108,65,100,100,114,101,115,115,97,109,97,116,101,117,114,97,110,
-100,114,111,105,100,97,108,108,101,103,101,100,105,108,108,110,101,115,115,119,
-97,108,107,105,110,103,99,101,110,116,101,114,115,113,117,97,108,105,102,121,109
-,97,116,99,104,101,115,117,110,105,102,105,101,100,101,120,116,105,110,99,116,68
-,101,102,101,110,115,101,100,105,101,100,32,105,110,10,9,60,33,45,45,32,99,117,
-115,116,111,109,115,108,105,110,107,105,110,103,76,105,116,116,108,101,32,66,111
-,111,107,32,111,102,101,118,101,110,105,110,103,109,105,110,46,106,115,63,97,114
-,101,32,116,104,101,107,111,110,116,97,107,116,116,111,100,97,121,39,115,46,104,
-116,109,108,34,32,116,97,114,103,101,116,61,119,101,97,114,105,110,103,65,108,
-108,32,82,105,103,59,10,125,41,40,41,59,114,97,105,115,105,110,103,32,65,108,115
-,111,44,32,99,114,117,99,105,97,108,97,98,111,117,116,34,62,100,101,99,108,97,
-114,101,45,45,62,10,60,115,99,102,105,114,101,102,111,120,97,115,32,109,117,99,
-104,97,112,112,108,105,101,115,105,110,100,101,120,44,32,115,44,32,98,117,116,32
-,116,121,112,101,32,61,32,10,13,10,60,33,45,45,116,111,119,97,114,100,115,82,101
-,99,111,114,100,115,80,114,105,118,97,116,101,70,111,114,101,105,103,110,80,114,
-101,109,105,101,114,99,104,111,105,99,101,115,86,105,114,116,117,97,108,114,101,
-116,117,114,110,115,67,111,109,109,101,110,116,80,111,119,101,114,101,100,105,
-110,108,105,110,101,59,112,111,118,101,114,116,121,99,104,97,109,98,101,114,76,
-105,118,105,110,103,32,118,111,108,117,109,101,115,65,110,116,104,111,110,121,
-108,111,103,105,110,34,32,82,101,108,97,116,101,100,69,99,111,110,111,109,121,
-114,101,97,99,104,101,115,99,117,116,116,105,110,103,103,114,97,118,105,116,121,
-108,105,102,101,32,105,110,67,104,97,112,116,101,114,45,115,104,97,100,111,119,
-78,111,116,97,98,108,101,60,47,116,100,62,13,10,32,114,101,116,117,114,110,115,
-116,97,100,105,117,109,119,105,100,103,101,116,115,118,97,114,121,105,110,103,
-116,114,97,118,101,108,115,104,101,108,100,32,98,121,119,104,111,32,97,114,101,
-119,111,114,107,32,105,110,102,97,99,117,108,116,121,97,110,103,117,108,97,114,
-119,104,111,32,104,97,100,97,105,114,112,111,114,116,116,111,119,110,32,111,102,
-10,10,83,111,109,101,32,39,99,108,105,99,107,39,99,104,97,114,103,101,115,107,
-101,121,119,111,114,100,105,116,32,119,105,108,108,99,105,116,121,32,111,102,40,
-116,104,105,115,41,59,65,110,100,114,101,119,32,117,110,105,113,117,101,32,99,
-104,101,99,107,101,100,111,114,32,109,111,114,101,51,48,48,112,120,59,32,114,101
-,116,117,114,110,59,114,115,105,111,110,61,34,112,108,117,103,105,110,115,119,
-105,116,104,105,110,32,104,101,114,115,101,108,102,83,116,97,116,105,111,110,70,
-101,100,101,114,97,108,118,101,110,116,117,114,101,112,117,98,108,105,115,104,
-115,101,110,116,32,116,111,116,101,110,115,105,111,110,97,99,116,114,101,115,115
-,99,111,109,101,32,116,111,102,105,110,103,101,114,115,68,117,107,101,32,111,102
-,112,101,111,112,108,101,44,101,120,112,108,111,105,116,119,104,97,116,32,105,
-115,104,97,114,109,111,110,121,97,32,109,97,106,111,114,34,58,34,104,116,116,112
-,105,110,32,104,105,115,32,109,101,110,117,34,62,10,109,111,110,116,104,108,121,
-111,102,102,105,99,101,114,99,111,117,110,99,105,108,103,97,105,110,105,110,103,
-101,118,101,110,32,105,110,83,117,109,109,97,114,121,100,97,116,101,32,111,102,
-108,111,121,97,108,116,121,102,105,116,110,101,115,115,97,110,100,32,119,97,115,
-101,109,112,101,114,111,114,115,117,112,114,101,109,101,83,101,99,111,110,100,32
-,104,101,97,114,105,110,103,82,117,115,115,105,97,110,108,111,110,103,101,115,
-116,65,108,98,101,114,116,97,108,97,116,101,114,97,108,115,101,116,32,111,102,32
-,115,109,97,108,108,34,62,46,97,112,112,101,110,100,100,111,32,119,105,116,104,
-102,101,100,101,114,97,108,98,97,110,107,32,111,102,98,101,110,101,97,116,104,68
-,101,115,112,105,116,101,67,97,112,105,116,97,108,103,114,111,117,110,100,115,41
-,44,32,97,110,100,32,112,101,114,99,101,110,116,105,116,32,102,114,111,109,99,
-108,111,115,105,110,103,99,111,110,116,97,105,110,73,110,115,116,101,97,100,102,
-105,102,116,101,101,110,97,115,32,119,101,108,108,46,121,97,104,111,111,46,114,
-101,115,112,111,110,100,102,105,103,104,116,101,114,111,98,115,99,117,114,101,
-114,101,102,108,101,99,116,111,114,103,97,110,105,99,61,32,77,97,116,104,46,101,
-100,105,116,105,110,103,111,110,108,105,110,101,32,112,97,100,100,105,110,103,97
-,32,119,104,111,108,101,111,110,101,114,114,111,114,121,101,97,114,32,111,102,
-101,110,100,32,111,102,32,98,97,114,114,105,101,114,119,104,101,110,32,105,116,
-104,101,97,100,101,114,32,104,111,109,101,32,111,102,114,101,115,117,109,101,100
-,114,101,110,97,109,101,100,115,116,114,111,110,103,62,104,101,97,116,105,110,
-103,114,101,116,97,105,110,115,99,108,111,117,100,102,114,119,97,121,32,111,102,
-32,77,97,114,99,104,32,49,107,110,111,119,105,110,103,105,110,32,112,97,114,116,
-66,101,116,119,101,101,110,108,101,115,115,111,110,115,99,108,111,115,101,115,
-116,118,105,114,116,117,97,108,108,105,110,107,115,34,62,99,114,111,115,115,101,
-100,69,78,68,32,45,45,62,102,97,109,111,117,115,32,97,119,97,114,100,101,100,76,
-105,99,101,110,115,101,72,101,97,108,116,104,32,102,97,105,114,108,121,32,119,
-101,97,108,116,104,121,109,105,110,105,109,97,108,65,102,114,105,99,97,110,99,
-111,109,112,101,116,101,108,97,98,101,108,34,62,115,105,110,103,105,110,103,102,
-97,114,109,101,114,115,66,114,97,115,105,108,41,100,105,115,99,117,115,115,114,
-101,112,108,97,99,101,71,114,101,103,111,114,121,102,111,110,116,32,99,111,112,
-117,114,115,117,101,100,97,112,112,101,97,114,115,109,97,107,101,32,117,112,114,
-111,117,110,100,101,100,98,111,116,104,32,111,102,98,108,111,99,107,101,100,115,
-97,119,32,116,104,101,111,102,102,105,99,101,115,99,111,108,111,117,114,115,105,
-102,40,100,111,99,117,119,104,101,110,32,104,101,101,110,102,111,114,99,101,112,
-117,115,104,40,102,117,65,117,103,117,115,116,32,85,84,70,45,56,34,62,70,97,110,
-116,97,115,121,105,110,32,109,111,115,116,105,110,106,117,114,101,100,85,115,117
-,97,108,108,121,102,97,114,109,105,110,103,99,108,111,115,117,114,101,111,98,106
-,101,99,116,32,100,101,102,101,110,99,101,117,115,101,32,111,102,32,77,101,100,
-105,99,97,108,60,98,111,100,121,62,10,101,118,105,100,101,110,116,98,101,32,117,
-115,101,100,107,101,121,67,111,100,101,115,105,120,116,101,101,110,73,115,108,97
-,109,105,99,35,48,48,48,48,48,48,101,110,116,105,114,101,32,119,105,100,101,108,
-121,32,97,99,116,105,118,101,32,40,116,121,112,101,111,102,111,110,101,32,99,97,
-110,99,111,108,111,114,32,61,115,112,101,97,107,101,114,101,120,116,101,110,100,
-115,80,104,121,115,105,99,115,116,101,114,114,97,105,110,60,116,98,111,100,121,
-62,102,117,110,101,114,97,108,118,105,101,119,105,110,103,109,105,100,100,108,
-101,32,99,114,105,99,107,101,116,112,114,111,112,104,101,116,115,104,105,102,116
-,101,100,100,111,99,116,111,114,115,82,117,115,115,101,108,108,32,116,97,114,103
-,101,116,99,111,109,112,97,99,116,97,108,103,101,98,114,97,115,111,99,105,97,108
-,45,98,117,108,107,32,111,102,109,97,110,32,97,110,100,60,47,116,100,62,10,32,
-104,101,32,108,101,102,116,41,46,118,97,108,40,41,102,97,108,115,101,41,59,108,
-111,103,105,99,97,108,98,97,110,107,105,110,103,104,111,109,101,32,116,111,110,
-97,109,105,110,103,32,65,114,105,122,111,110,97,99,114,101,100,105,116,115,41,59
-,10,125,41,59,10,102,111,117,110,100,101,114,105,110,32,116,117,114,110,67,111,
-108,108,105,110,115,98,101,102,111,114,101,32,66,117,116,32,116,104,101,99,104,
-97,114,103,101,100,84,105,116,108,101,34,62,67,97,112,116,97,105,110,115,112,101
-,108,108,101,100,103,111,100,100,101,115,115,84,97,103,32,45,45,62,65,100,100,
-105,110,103,58,98,117,116,32,119,97,115,82,101,99,101,110,116,32,112,97,116,105,
-101,110,116,98,97,99,107,32,105,110,61,102,97,108,115,101,38,76,105,110,99,111,
-108,110,119,101,32,107,110,111,119,67,111,117,110,116,101,114,74,117,100,97,105,
-115,109,115,99,114,105,112,116,32,97,108,116,101,114,101,100,39,93,41,59,10,32,
-32,104,97,115,32,116,104,101,117,110,99,108,101,97,114,69,118,101,110,116,39,44,
-98,111,116,104,32,105,110,110,111,116,32,97,108,108,10,10,60,33,45,45,32,112,108
-,97,99,105,110,103,104,97,114,100,32,116,111,32,99,101,110,116,101,114,115,111,
-114,116,32,111,102,99,108,105,101,110,116,115,115,116,114,101,101,116,115,66,101
-,114,110,97,114,100,97,115,115,101,114,116,115,116,101,110,100,32,116,111,102,97
-,110,116,97,115,121,100,111,119,110,32,105,110,104,97,114,98,111,117,114,70,114,
-101,101,100,111,109,106,101,119,101,108,114,121,47,97,98,111,117,116,46,46,115,
-101,97,114,99,104,108,101,103,101,110,100,115,105,115,32,109,97,100,101,109,111,
-100,101,114,110,32,111,110,108,121,32,111,110,111,110,108,121,32,116,111,105,109
-,97,103,101,34,32,108,105,110,101,97,114,32,112,97,105,110,116,101,114,97,110,
-100,32,110,111,116,114,97,114,101,108,121,32,97,99,114,111,110,121,109,100,101,
-108,105,118,101,114,115,104,111,114,116,101,114,48,48,38,97,109,112,59,97,115,32
-,109,97,110,121,119,105,100,116,104,61,34,47,42,32,60,33,91,67,116,105,116,108,
-101,32,61,111,102,32,116,104,101,32,108,111,119,101,115,116,32,112,105,99,107,
-101,100,32,101,115,99,97,112,101,100,117,115,101,115,32,111,102,112,101,111,112,
-108,101,115,32,80,117,98,108,105,99,77,97,116,116,104,101,119,116,97,99,116,105,
-99,115,100,97,109,97,103,101,100,119,97,121,32,102,111,114,108,97,119,115,32,111
-,102,101,97,115,121,32,116,111,32,119,105,110,100,111,119,115,116,114,111,110,
-103,32,32,115,105,109,112,108,101,125,99,97,116,99,104,40,115,101,118,101,110,
-116,104,105,110,102,111,98,111,120,119,101,110,116,32,116,111,112,97,105,110,116
-,101,100,99,105,116,105,122,101,110,73,32,100,111,110,39,116,114,101,116,114,101
-,97,116,46,32,83,111,109,101,32,119,119,46,34,41,59,10,98,111,109,98,105,110,103
-,109,97,105,108,116,111,58,109,97,100,101,32,105,110,46,32,77,97,110,121,32,99,
-97,114,114,105,101,115,124,124,123,125,59,119,105,119,111,114,107,32,111,102,115
-,121,110,111,110,121,109,100,101,102,101,97,116,115,102,97,118,111,114,101,100,
-111,112,116,105,99,97,108,112,97,103,101,84,114,97,117,110,108,101,115,115,32,
-115,101,110,100,105,110,103,108,101,102,116,34,62,60,99,111,109,83,99,111,114,65
-,108,108,32,116,104,101,106,81,117,101,114,121,46,116,111,117,114,105,115,116,67
-,108,97,115,115,105,99,102,97,108,115,101,34,32,87,105,108,104,101,108,109,115,
-117,98,117,114,98,115,103,101,110,117,105,110,101,98,105,115,104,111,112,115,46,
-115,112,108,105,116,40,103,108,111,98,97,108,32,102,111,108,108,111,119,115,98,
-111,100,121,32,111,102,110,111,109,105,110,97,108,67,111,110,116,97,99,116,115,
-101,99,117,108,97,114,108,101,102,116,32,116,111,99,104,105,101,102,108,121,45,
-104,105,100,100,101,110,45,98,97,110,110,101,114,60,47,108,105,62,10,10,46,32,87
-,104,101,110,32,105,110,32,98,111,116,104,100,105,115,109,105,115,115,69,120,112
-,108,111,114,101,97,108,119,97,121,115,32,118,105,97,32,116,104,101,115,112,97,
-195,177,111,108,119,101,108,102,97,114,101,114,117,108,105,110,103,32,97,114,114
-,97,110,103,101,99,97,112,116,97,105,110,104,105,115,32,115,111,110,114,117,108,
-101,32,111,102,104,101,32,116,111,111,107,105,116,115,101,108,102,44,61,48,38,97
-,109,112,59,40,99,97,108,108,101,100,115,97,109,112,108,101,115,116,111,32,109,
-97,107,101,99,111,109,47,112,97,103,77,97,114,116,105,110,32,75,101,110,110,101,
-100,121,97,99,99,101,112,116,115,102,117,108,108,32,111,102,104,97,110,100,108,
-101,100,66,101,115,105,100,101,115,47,47,45,45,62,60,47,97,98,108,101,32,116,111
-,116,97,114,103,101,116,115,101,115,115,101,110,99,101,104,105,109,32,116,111,32
-,105,116,115,32,98,121,32,99,111,109,109,111,110,46,109,105,110,101,114,97,108,
-116,111,32,116,97,107,101,119,97,121,115,32,116,111,115,46,111,114,103,47,108,97
-,100,118,105,115,101,100,112,101,110,97,108,116,121,115,105,109,112,108,101,58,
-105,102,32,116,104,101,121,76,101,116,116,101,114,115,97,32,115,104,111,114,116,
-72,101,114,98,101,114,116,115,116,114,105,107,101,115,32,103,114,111,117,112,115
-,46,108,101,110,103,116,104,102,108,105,103,104,116,115,111,118,101,114,108,97,
-112,115,108,111,119,108,121,32,108,101,115,115,101,114,32,115,111,99,105,97,108,
-32,60,47,112,62,10,9,9,105,116,32,105,110,116,111,114,97,110,107,101,100,32,114,
-97,116,101,32,111,102,117,108,62,13,10,32,32,97,116,116,101,109,112,116,112,97,
-105,114,32,111,102,109,97,107,101,32,105,116,75,111,110,116,97,107,116,65,110,
-116,111,110,105,111,104,97,118,105,110,103,32,114,97,116,105,110,103,115,32,97,
-99,116,105,118,101,115,116,114,101,97,109,115,116,114,97,112,112,101,100,34,41,
-46,99,115,115,40,104,111,115,116,105,108,101,108,101,97,100,32,116,111,108,105,
-116,116,108,101,32,103,114,111,117,112,115,44,80,105,99,116,117,114,101,45,45,62
-,13,10,13,10,32,114,111,119,115,61,34,32,111,98,106,101,99,116,105,110,118,101,
-114,115,101,60,102,111,111,116,101,114,67,117,115,116,111,109,86,62,60,92,47,115
-,99,114,115,111,108,118,105,110,103,67,104,97,109,98,101,114,115,108,97,118,101,
-114,121,119,111,117,110,100,101,100,119,104,101,114,101,97,115,33,61,32,39,117,
-110,100,102,111,114,32,97,108,108,112,97,114,116,108,121,32,45,114,105,103,104,
-116,58,65,114,97,98,105,97,110,98,97,99,107,101,100,32,99,101,110,116,117,114,
-121,117,110,105,116,32,111,102,109,111,98,105,108,101,45,69,117,114,111,112,101,
-44,105,115,32,104,111,109,101,114,105,115,107,32,111,102,100,101,115,105,114,101
-,100,67,108,105,110,116,111,110,99,111,115,116,32,111,102,97,103,101,32,111,102,
-32,98,101,99,111,109,101,32,110,111,110,101,32,111,102,112,38,113,117,111,116,59
-,77,105,100,100,108,101,32,101,97,100,39,41,91,48,67,114,105,116,105,99,115,115,
-116,117,100,105,111,115,62,38,99,111,112,121,59,103,114,111,117,112,34,62,97,115
-,115,101,109,98,108,109,97,107,105,110,103,32,112,114,101,115,115,101,100,119,
-105,100,103,101,116,46,112,115,58,34,32,63,32,114,101,98,117,105,108,116,98,121,
-32,115,111,109,101,70,111,114,109,101,114,32,101,100,105,116,111,114,115,100,101
-,108,97,121,101,100,67,97,110,111,110,105,99,104,97,100,32,116,104,101,112,117,
-115,104,105,110,103,99,108,97,115,115,61,34,98,117,116,32,97,114,101,112,97,114,
-116,105,97,108,66,97,98,121,108,111,110,98,111,116,116,111,109,32,99,97,114,114,
-105,101,114,67,111,109,109,97,110,100,105,116,115,32,117,115,101,65,115,32,119,
-105,116,104,99,111,117,114,115,101,115,97,32,116,104,105,114,100,100,101,110,111
-,116,101,115,97,108,115,111,32,105,110,72,111,117,115,116,111,110,50,48,112,120,
-59,34,62,97,99,99,117,115,101,100,100,111,117,98,108,101,32,103,111,97,108,32,
-111,102,70,97,109,111,117,115,32,41,46,98,105,110,100,40,112,114,105,101,115,116
-,115,32,79,110,108,105,110,101,105,110,32,74,117,108,121,115,116,32,43,32,34,103
-,99,111,110,115,117,108,116,100,101,99,105,109,97,108,104,101,108,112,102,117,
-108,114,101,118,105,118,101,100,105,115,32,118,101,114,121,114,39,43,39,105,112,
-116,108,111,115,105,110,103,32,102,101,109,97,108,101,115,105,115,32,97,108,115,
-111,115,116,114,105,110,103,115,100,97,121,115,32,111,102,97,114,114,105,118,97,
-108,102,117,116,117,114,101,32,60,111,98,106,101,99,116,102,111,114,99,105,110,
-103,83,116,114,105,110,103,40,34,32,47,62,10,9,9,104,101,114,101,32,105,115,101,
-110,99,111,100,101,100,46,32,32,84,104,101,32,98,97,108,108,111,111,110,100,111,
-110,101,32,98,121,47,99,111,109,109,111,110,98,103,99,111,108,111,114,108,97,119
-,32,111,102,32,73,110,100,105,97,110,97,97,118,111,105,100,101,100,98,117,116,32
-,116,104,101,50,112,120,32,51,112,120,106,113,117,101,114,121,46,97,102,116,101,
-114,32,97,112,111,108,105,99,121,46,109,101,110,32,97,110,100,102,111,111,116,
-101,114,45,61,32,116,114,117,101,59,102,111,114,32,117,115,101,115,99,114,101,
-101,110,46,73,110,100,105,97,110,32,105,109,97,103,101,32,61,102,97,109,105,108,
-121,44,104,116,116,112,58,47,47,32,38,110,98,115,112,59,100,114,105,118,101,114,
-115,101,116,101,114,110,97,108,115,97,109,101,32,97,115,110,111,116,105,99,101,
-100,118,105,101,119,101,114,115,125,41,40,41,59,10,32,105,115,32,109,111,114,101
-,115,101,97,115,111,110,115,102,111,114,109,101,114,32,116,104,101,32,110,101,
-119,105,115,32,106,117,115,116,99,111,110,115,101,110,116,32,83,101,97,114,99,
-104,119,97,115,32,116,104,101,119,104,121,32,116,104,101,115,104,105,112,112,101
-,100,98,114,62,60,98,114,62,119,105,100,116,104,58,32,104,101,105,103,104,116,61
-,109,97,100,101,32,111,102,99,117,105,115,105,110,101,105,115,32,116,104,97,116,
-97,32,118,101,114,121,32,65,100,109,105,114,97,108,32,102,105,120,101,100,59,110
-,111,114,109,97,108,32,77,105,115,115,105,111,110,80,114,101,115,115,44,32,111,
-110,116,97,114,105,111,99,104,97,114,115,101,116,116,114,121,32,116,111,32,105,
-110,118,97,100,101,100,61,34,116,114,117,101,34,115,112,97,99,105,110,103,105,
-115,32,109,111,115,116,97,32,109,111,114,101,32,116,111,116,97,108,108,121,102,
-97,108,108,32,111,102,125,41,59,13,10,32,32,105,109,109,101,110,115,101,116,105,
-109,101,32,105,110,115,101,116,32,111,117,116,115,97,116,105,115,102,121,116,111
-,32,102,105,110,100,100,111,119,110,32,116,111,108,111,116,32,111,102,32,80,108,
-97,121,101,114,115,105,110,32,74,117,110,101,113,117,97,110,116,117,109,110,111,
-116,32,116,104,101,116,105,109,101,32,116,111,100,105,115,116,97,110,116,70,105,
-110,110,105,115,104,115,114,99,32,61,32,40,115,105,110,103,108,101,32,104,101,
-108,112,32,111,102,71,101,114,109,97,110,32,108,97,119,32,97,110,100,108,97,98,
-101,108,101,100,102,111,114,101,115,116,115,99,111,111,107,105,110,103,115,112,
-97,99,101,34,62,104,101,97,100,101,114,45,119,101,108,108,32,97,115,83,116,97,
-110,108,101,121,98,114,105,100,103,101,115,47,103,108,111,98,97,108,67,114,111,
-97,116,105,97,32,65,98,111,117,116,32,91,48,93,59,10,32,32,105,116,44,32,97,110,
-100,103,114,111,117,112,101,100,98,101,105,110,103,32,97,41,123,116,104,114,111,
-119,104,101,32,109,97,100,101,108,105,103,104,116,101,114,101,116,104,105,99,97,
-108,70,70,70,70,70,70,34,98,111,116,116,111,109,34,108,105,107,101,32,97,32,101,
-109,112,108,111,121,115,108,105,118,101,32,105,110,97,115,32,115,101,101,110,112
-,114,105,110,116,101,114,109,111,115,116,32,111,102,117,98,45,108,105,110,107,
-114,101,106,101,99,116,115,97,110,100,32,117,115,101,105,109,97,103,101,34,62,
-115,117,99,99,101,101,100,102,101,101,100,105,110,103,78,117,99,108,101,97,114,
-105,110,102,111,114,109,97,116,111,32,104,101,108,112,87,111,109,101,110,39,115,
-78,101,105,116,104,101,114,77,101,120,105,99,97,110,112,114,111,116,101,105,110,
-60,116,97,98,108,101,32,98,121,32,109,97,110,121,104,101,97,108,116,104,121,108,
-97,119,115,117,105,116,100,101,118,105,115,101,100,46,112,117,115,104,40,123,115
-,101,108,108,101,114,115,115,105,109,112,108,121,32,84,104,114,111,117,103,104,
-46,99,111,111,107,105,101,32,73,109,97,103,101,40,111,108,100,101,114,34,62,117,
-115,46,106,115,34,62,32,83,105,110,99,101,32,117,110,105,118,101,114,115,108,97,
-114,103,101,114,32,111,112,101,110,32,116,111,33,45,45,32,101,110,100,108,105,
-101,115,32,105,110,39,93,41,59,13,10,32,32,109,97,114,107,101,116,119,104,111,32
-,105,115,32,40,34,68,79,77,67,111,109,97,110,97,103,101,100,111,110,101,32,102,
-111,114,116,121,112,101,111,102,32,75,105,110,103,100,111,109,112,114,111,102,
-105,116,115,112,114,111,112,111,115,101,116,111,32,115,104,111,119,99,101,110,
-116,101,114,59,109,97,100,101,32,105,116,100,114,101,115,115,101,100,119,101,114
-,101,32,105,110,109,105,120,116,117,114,101,112,114,101,99,105,115,101,97,114,
-105,115,105,110,103,115,114,99,32,61,32,39,109,97,107,101,32,97,32,115,101,99,
-117,114,101,100,66,97,112,116,105,115,116,118,111,116,105,110,103,32,10,9,9,118,
-97,114,32,77,97,114,99,104,32,50,103,114,101,119,32,117,112,67,108,105,109,97,
-116,101,46,114,101,109,111,118,101,115,107,105,108,108,101,100,119,97,121,32,116
-,104,101,60,47,104,101,97,100,62,102,97,99,101,32,111,102,97,99,116,105,110,103,
-32,114,105,103,104,116,34,62,116,111,32,119,111,114,107,114,101,100,117,99,101,
-115,104,97,115,32,104,97,100,101,114,101,99,116,101,100,115,104,111,119,40,41,59
-,97,99,116,105,111,110,61,98,111,111,107,32,111,102,97,110,32,97,114,101,97,61,
-61,32,34,104,116,116,60,104,101,97,100,101,114,10,60,104,116,109,108,62,99,111,
-110,102,111,114,109,102,97,99,105,110,103,32,99,111,111,107,105,101,46,114,101,
-108,121,32,111,110,104,111,115,116,101,100,32,46,99,117,115,116,111,109,104,101,
-32,119,101,110,116,98,117,116,32,102,111,114,115,112,114,101,97,100,32,70,97,109
-,105,108,121,32,97,32,109,101,97,110,115,111,117,116,32,116,104,101,102,111,114,
-117,109,115,46,102,111,111,116,97,103,101,34,62,77,111,98,105,108,67,108,101,109
-,101,110,116,115,34,32,105,100,61,34,97,115,32,104,105,103,104,105,110,116,101,
-110,115,101,45,45,62,60,33,45,45,102,101,109,97,108,101,32,105,115,32,115,101,
-101,110,105,109,112,108,105,101,100,115,101,116,32,116,104,101,97,32,115,116,97,
-116,101,97,110,100,32,104,105,115,102,97,115,116,101,115,116,98,101,115,105,100,
-101,115,98,117,116,116,111,110,95,98,111,117,110,100,101,100,34,62,60,105,109,
-103,32,73,110,102,111,98,111,120,101,118,101,110,116,115,44,97,32,121,111,117,
-110,103,97,110,100,32,97,114,101,78,97,116,105,118,101,32,99,104,101,97,112,101,
-114,84,105,109,101,111,117,116,97,110,100,32,104,97,115,101,110,103,105,110,101,
-115,119,111,110,32,116,104,101,40,109,111,115,116,108,121,114,105,103,104,116,58
-,32,102,105,110,100,32,97,32,45,98,111,116,116,111,109,80,114,105,110,99,101,32,
-97,114,101,97,32,111,102,109,111,114,101,32,111,102,115,101,97,114,99,104,95,110
-,97,116,117,114,101,44,108,101,103,97,108,108,121,112,101,114,105,111,100,44,108
-,97,110,100,32,111,102,111,114,32,119,105,116,104,105,110,100,117,99,101,100,112
-,114,111,118,105,110,103,109,105,115,115,105,108,101,108,111,99,97,108,108,121,
-65,103,97,105,110,115,116,116,104,101,32,119,97,121,107,38,113,117,111,116,59,
-112,120,59,34,62,13,10,112,117,115,104,101,100,32,97,98,97,110,100,111,110,110,
-117,109,101,114,97,108,67,101,114,116,97,105,110,73,110,32,116,104,105,115,109,
-111,114,101,32,105,110,111,114,32,115,111,109,101,110,97,109,101,32,105,115,97,
-110,100,44,32,105,110,99,114,111,119,110,101,100,73,83,66,78,32,48,45,99,114,101
-,97,116,101,115,79,99,116,111,98,101,114,109,97,121,32,110,111,116,99,101,110,
-116,101,114,32,108,97,116,101,32,105,110,68,101,102,101,110,99,101,101,110,97,99
-,116,101,100,119,105,115,104,32,116,111,98,114,111,97,100,108,121,99,111,111,108
-,105,110,103,111,110,108,111,97,100,61,105,116,46,32,84,104,101,114,101,99,111,
-118,101,114,77,101,109,98,101,114,115,104,101,105,103,104,116,32,97,115,115,117,
-109,101,115,60,104,116,109,108,62,10,112,101,111,112,108,101,46,105,110,32,111,
-110,101,32,61,119,105,110,100,111,119,102,111,111,116,101,114,95,97,32,103,111,
-111,100,32,114,101,107,108,97,109,97,111,116,104,101,114,115,44,116,111,32,116,
-104,105,115,95,99,111,111,107,105,101,112,97,110,101,108,34,62,76,111,110,100,
-111,110,44,100,101,102,105,110,101,115,99,114,117,115,104,101,100,98,97,112,116,
-105,115,109,99,111,97,115,116,97,108,115,116,97,116,117,115,32,116,105,116,108,
-101,34,32,109,111,118,101,32,116,111,108,111,115,116,32,105,110,98,101,116,116,
-101,114,32,105,109,112,108,105,101,115,114,105,118,97,108,114,121,115,101,114,
-118,101,114,115,32,83,121,115,116,101,109,80,101,114,104,97,112,115,101,115,32,
-97,110,100,32,99,111,110,116,101,110,100,102,108,111,119,105,110,103,108,97,115,
-116,101,100,32,114,105,115,101,32,105,110,71,101,110,101,115,105,115,118,105,101
-,119,32,111,102,114,105,115,105,110,103,32,115,101,101,109,32,116,111,98,117,116
-,32,105,110,32,98,97,99,107,105,110,103,104,101,32,119,105,108,108,103,105,118,
-101,110,32,97,103,105,118,105,110,103,32,99,105,116,105,101,115,46,102,108,111,
-119,32,111,102,32,76,97,116,101,114,32,97,108,108,32,98,117,116,72,105,103,104,
-119,97,121,111,110,108,121,32,98,121,115,105,103,110,32,111,102,104,101,32,100,
-111,101,115,100,105,102,102,101,114,115,98,97,116,116,101,114,121,38,97,109,112,
-59,108,97,115,105,110,103,108,101,115,116,104,114,101,97,116,115,105,110,116,101
-,103,101,114,116,97,107,101,32,111,110,114,101,102,117,115,101,100,99,97,108,108
-,101,100,32,61,85,83,38,97,109,112,83,101,101,32,116,104,101,110,97,116,105,118,
-101,115,98,121,32,116,104,105,115,115,121,115,116,101,109,46,104,101,97,100,32,
-111,102,58,104,111,118,101,114,44,108,101,115,98,105,97,110,115,117,114,110,97,
-109,101,97,110,100,32,97,108,108,99,111,109,109,111,110,47,104,101,97,100,101,
-114,95,95,112,97,114,97,109,115,72,97,114,118,97,114,100,47,112,105,120,101,108,
-46,114,101,109,111,118,97,108,115,111,32,108,111,110,103,114,111,108,101,32,111,
-102,106,111,105,110,116,108,121,115,107,121,115,99,114,97,85,110,105,99,111,100,
-101,98,114,32,47,62,13,10,65,116,108,97,110,116,97,110,117,99,108,101,117,115,67
-,111,117,110,116,121,44,112,117,114,101,108,121,32,99,111,117,110,116,34,62,101,
-97,115,105,108,121,32,98,117,105,108,100,32,97,111,110,99,108,105,99,107,97,32,
-103,105,118,101,110,112,111,105,110,116,101,114,104,38,113,117,111,116,59,101,
-118,101,110,116,115,32,101,108,115,101,32,123,10,100,105,116,105,111,110,115,110
-,111,119,32,116,104,101,44,32,119,105,116,104,32,109,97,110,32,119,104,111,111,
-114,103,47,87,101,98,111,110,101,32,97,110,100,99,97,118,97,108,114,121,72,101,
-32,100,105,101,100,115,101,97,116,116,108,101,48,48,44,48,48,48,32,123,119,105,
-110,100,111,119,104,97,118,101,32,116,111,105,102,40,119,105,110,100,97,110,100,
-32,105,116,115,115,111,108,101,108,121,32,109,38,113,117,111,116,59,114,101,110,
-101,119,101,100,68,101,116,114,111,105,116,97,109,111,110,103,115,116,101,105,
-116,104,101,114,32,116,104,101,109,32,105,110,83,101,110,97,116,111,114,85,115,
-60,47,97,62,60,75,105,110,103,32,111,102,70,114,97,110,99,105,115,45,112,114,111
-,100,117,99,104,101,32,117,115,101,100,97,114,116,32,97,110,100,104,105,109,32,
-97,110,100,117,115,101,100,32,98,121,115,99,111,114,105,110,103,97,116,32,104,
-111,109,101,116,111,32,104,97,118,101,114,101,108,97,116,101,115,105,98,105,108,
-105,116,121,102,97,99,116,105,111,110,66,117,102,102,97,108,111,108,105,110,107,
-34,62,60,119,104,97,116,32,104,101,102,114,101,101,32,116,111,67,105,116,121,32,
-111,102,99,111,109,101,32,105,110,115,101,99,116,111,114,115,99,111,117,110,116,
-101,100,111,110,101,32,100,97,121,110,101,114,118,111,117,115,115,113,117,97,114
-,101,32,125,59,105,102,40,103,111,105,110,32,119,104,97,116,105,109,103,34,32,97
-,108,105,115,32,111,110,108,121,115,101,97,114,99,104,47,116,117,101,115,100,97,
-121,108,111,111,115,101,108,121,83,111,108,111,109,111,110,115,101,120,117,97,
-108,32,45,32,60,97,32,104,114,109,101,100,105,117,109,34,68,79,32,78,79,84,32,70
-,114,97,110,99,101,44,119,105,116,104,32,97,32,119,97,114,32,97,110,100,115,101,
-99,111,110,100,32,116,97,107,101,32,97,32,62,13,10,13,10,13,10,109,97,114,107,
-101,116,46,104,105,103,104,119,97,121,100,111,110,101,32,105,110,99,116,105,118,
-105,116,121,34,108,97,115,116,34,62,111,98,108,105,103,101,100,114,105,115,101,
-32,116,111,34,117,110,100,101,102,105,109,97,100,101,32,116,111,32,69,97,114,108
-,121,32,112,114,97,105,115,101,100,105,110,32,105,116,115,32,102,111,114,32,104,
-105,115,97,116,104,108,101,116,101,74,117,112,105,116,101,114,89,97,104,111,111,
-33,32,116,101,114,109,101,100,32,115,111,32,109,97,110,121,114,101,97,108,108,
-121,32,115,46,32,84,104,101,32,97,32,119,111,109,97,110,63,118,97,108,117,101,61
-,100,105,114,101,99,116,32,114,105,103,104,116,34,32,98,105,99,121,99,108,101,97
-,99,105,110,103,61,34,100,97,121,32,97,110,100,115,116,97,116,105,110,103,82,97,
-116,104,101,114,44,104,105,103,104,101,114,32,79,102,102,105,99,101,32,97,114,
-101,32,110,111,119,116,105,109,101,115,44,32,119,104,101,110,32,97,32,112,97,121
-,32,102,111,114,111,110,32,116,104,105,115,45,108,105,110,107,34,62,59,98,111,
-114,100,101,114,97,114,111,117,110,100,32,97,110,110,117,97,108,32,116,104,101,
-32,78,101,119,112,117,116,32,116,104,101,46,99,111,109,34,32,116,97,107,105,110,
-32,116,111,97,32,98,114,105,101,102,40,105,110,32,116,104,101,103,114,111,117,
-112,115,46,59,32,119,105,100,116,104,101,110,122,121,109,101,115,115,105,109,112
-,108,101,32,105,110,32,108,97,116,101,123,114,101,116,117,114,110,116,104,101,
-114,97,112,121,97,32,112,111,105,110,116,98,97,110,110,105,110,103,105,110,107,
-115,34,62,10,40,41,59,34,32,114,101,97,32,112,108,97,99,101,92,117,48,48,51,67,
-97,97,98,111,117,116,32,97,116,114,62,13,10,9,9,99,99,111,117,110,116,32,103,105
-,118,101,115,32,97,60,83,67,82,73,80,84,82,97,105,108,119,97,121,116,104,101,109
-,101,115,47,116,111,111,108,98,111,120,66,121,73,100,40,34,120,104,117,109,97,
-110,115,44,119,97,116,99,104,101,115,105,110,32,115,111,109,101,32,105,102,32,40
-,119,105,99,111,109,105,110,103,32,102,111,114,109,97,116,115,32,85,110,100,101,
-114,32,98,117,116,32,104,97,115,104,97,110,100,101,100,32,109,97,100,101,32,98,
-121,116,104,97,110,32,105,110,102,101,97,114,32,111,102,100,101,110,111,116,101,
-100,47,105,102,114,97,109,101,108,101,102,116,32,105,110,118,111,108,116,97,103,
-101,105,110,32,101,97,99,104,97,38,113,117,111,116,59,98,97,115,101,32,111,102,
-73,110,32,109,97,110,121,117,110,100,101,114,103,111,114,101,103,105,109,101,115
-,97,99,116,105,111,110,32,60,47,112,62,13,10,60,117,115,116,111,109,86,97,59,38,
-103,116,59,60,47,105,109,112,111,114,116,115,111,114,32,116,104,97,116,109,111,
-115,116,108,121,32,38,97,109,112,59,114,101,32,115,105,122,101,61,34,60,47,97,62
-,60,47,104,97,32,99,108,97,115,115,112,97,115,115,105,118,101,72,111,115,116,32,
-61,32,87,104,101,116,104,101,114,102,101,114,116,105,108,101,86,97,114,105,111,
-117,115,61,91,93,59,40,102,117,99,97,109,101,114,97,115,47,62,60,47,116,100,62,
-97,99,116,115,32,97,115,73,110,32,115,111,109,101,62,13,10,13,10,60,33,111,114,
-103,97,110,105,115,32,60,98,114,32,47,62,66,101,105,106,105,110,103,99,97,116,97
-,108,195,160,100,101,117,116,115,99,104,101,117,114,111,112,101,117,101,117,115,
-107,97,114,97,103,97,101,105,108,103,101,115,118,101,110,115,107,97,101,115,112,
-97,195,177,97,109,101,110,115,97,106,101,117,115,117,97,114,105,111,116,114,97,
-98,97,106,111,109,195,169,120,105,99,111,112,195,161,103,105,110,97,115,105,101,
-109,112,114,101,115,105,115,116,101,109,97,111,99,116,117,98,114,101,100,117,114
-,97,110,116,101,97,195,177,97,100,105,114,101,109,112,114,101,115,97,109,111,109
-,101,110,116,111,110,117,101,115,116,114,111,112,114,105,109,101,114,97,116,114,
-97,118,195,169,115,103,114,97,99,105,97,115,110,117,101,115,116,114,97,112,114,
-111,99,101,115,111,101,115,116,97,100,111,115,99,97,108,105,100,97,100,112,101,
-114,115,111,110,97,110,195,186,109,101,114,111,97,99,117,101,114,100,111,109,195
-,186,115,105,99,97,109,105,101,109,98,114,111,111,102,101,114,116,97,115,97,108,
-103,117,110,111,115,112,97,195,173,115,101,115,101,106,101,109,112,108,111,100,
-101,114,101,99,104,111,97,100,101,109,195,161,115,112,114,105,118,97,100,111,97,
-103,114,101,103,97,114,101,110,108,97,99,101,115,112,111,115,105,98,108,101,104,
-111,116,101,108,101,115,115,101,118,105,108,108,97,112,114,105,109,101,114,111,
-195,186,108,116,105,109,111,101,118,101,110,116,111,115,97,114,99,104,105,118,
-111,99,117,108,116,117,114,97,109,117,106,101,114,101,115,101,110,116,114,97,100
-,97,97,110,117,110,99,105,111,101,109,98,97,114,103,111,109,101,114,99,97,100,
-111,103,114,97,110,100,101,115,101,115,116,117,100,105,111,109,101,106,111,114,
-101,115,102,101,98,114,101,114,111,100,105,115,101,195,177,111,116,117,114,105,
-115,109,111,99,195,179,100,105,103,111,112,111,114,116,97,100,97,101,115,112,97,
-99,105,111,102,97,109,105,108,105,97,97,110,116,111,110,105,111,112,101,114,109,
-105,116,101,103,117,97,114,100,97,114,97,108,103,117,110,97,115,112,114,101,99,
-105,111,115,97,108,103,117,105,101,110,115,101,110,116,105,100,111,118,105,115,
-105,116,97,115,116,195,173,116,117,108,111,99,111,110,111,99,101,114,115,101,103
-,117,110,100,111,99,111,110,115,101,106,111,102,114,97,110,99,105,97,109,105,110
-,117,116,111,115,115,101,103,117,110,100,97,116,101,110,101,109,111,115,101,102,
-101,99,116,111,115,109,195,161,108,97,103,97,115,101,115,105,195,179,110,114,101
-,118,105,115,116,97,103,114,97,110,97,100,97,99,111,109,112,114,97,114,105,110,
-103,114,101,115,111,103,97,114,99,195,173,97,97,99,99,105,195,179,110,101,99,117
-,97,100,111,114,113,117,105,101,110,101,115,105,110,99,108,117,115,111,100,101,
-98,101,114,195,161,109,97,116,101,114,105,97,104,111,109,98,114,101,115,109,117,
-101,115,116,114,97,112,111,100,114,195,173,97,109,97,195,177,97,110,97,195,186,
-108,116,105,109,97,101,115,116,97,109,111,115,111,102,105,99,105,97,108,116,97,
-109,98,105,101,110,110,105,110,103,195,186,110,115,97,108,117,100,111,115,112,
-111,100,101,109,111,115,109,101,106,111,114,97,114,112,111,115,105,116,105,111,
-110,98,117,115,105,110,101,115,115,104,111,109,101,112,97,103,101,115,101,99,117
-,114,105,116,121,108,97,110,103,117,97,103,101,115,116,97,110,100,97,114,100,99,
-97,109,112,97,105,103,110,102,101,97,116,117,114,101,115,99,97,116,101,103,111,
-114,121,101,120,116,101,114,110,97,108,99,104,105,108,100,114,101,110,114,101,
-115,101,114,118,101,100,114,101,115,101,97,114,99,104,101,120,99,104,97,110,103,
-101,102,97,118,111,114,105,116,101,116,101,109,112,108,97,116,101,109,105,108,
-105,116,97,114,121,105,110,100,117,115,116,114,121,115,101,114,118,105,99,101,
-115,109,97,116,101,114,105,97,108,112,114,111,100,117,99,116,115,122,45,105,110,
-100,101,120,58,99,111,109,109,101,110,116,115,115,111,102,116,119,97,114,101,99,
-111,109,112,108,101,116,101,99,97,108,101,110,100,97,114,112,108,97,116,102,111,
-114,109,97,114,116,105,99,108,101,115,114,101,113,117,105,114,101,100,109,111,
-118,101,109,101,110,116,113,117,101,115,116,105,111,110,98,117,105,108,100,105,
-110,103,112,111,108,105,116,105,99,115,112,111,115,115,105,98,108,101,114,101,
-108,105,103,105,111,110,112,104,121,115,105,99,97,108,102,101,101,100,98,97,99,
-107,114,101,103,105,115,116,101,114,112,105,99,116,117,114,101,115,100,105,115,
-97,98,108,101,100,112,114,111,116,111,99,111,108,97,117,100,105,101,110,99,101,
-115,101,116,116,105,110,103,115,97,99,116,105,118,105,116,121,101,108,101,109,
-101,110,116,115,108,101,97,114,110,105,110,103,97,110,121,116,104,105,110,103,97
-,98,115,116,114,97,99,116,112,114,111,103,114,101,115,115,111,118,101,114,118,
-105,101,119,109,97,103,97,122,105,110,101,101,99,111,110,111,109,105,99,116,114,
-97,105,110,105,110,103,112,114,101,115,115,117,114,101,118,97,114,105,111,117,
-115,32,60,115,116,114,111,110,103,62,112,114,111,112,101,114,116,121,115,104,111
-,112,112,105,110,103,116,111,103,101,116,104,101,114,97,100,118,97,110,99,101,
-100,98,101,104,97,118,105,111,114,100,111,119,110,108,111,97,100,102,101,97,116,
-117,114,101,100,102,111,111,116,98,97,108,108,115,101,108,101,99,116,101,100,76,
-97,110,103,117,97,103,101,100,105,115,116,97,110,99,101,114,101,109,101,109,98,
-101,114,116,114,97,99,107,105,110,103,112,97,115,115,119,111,114,100,109,111,100
-,105,102,105,101,100,115,116,117,100,101,110,116,115,100,105,114,101,99,116,108,
-121,102,105,103,104,116,105,110,103,110,111,114,116,104,101,114,110,100,97,116,
-97,98,97,115,101,102,101,115,116,105,118,97,108,98,114,101,97,107,105,110,103,
-108,111,99,97,116,105,111,110,105,110,116,101,114,110,101,116,100,114,111,112,
-100,111,119,110,112,114,97,99,116,105,99,101,101,118,105,100,101,110,99,101,102,
-117,110,99,116,105,111,110,109,97,114,114,105,97,103,101,114,101,115,112,111,110
-,115,101,112,114,111,98,108,101,109,115,110,101,103,97,116,105,118,101,112,114,
-111,103,114,97,109,115,97,110,97,108,121,115,105,115,114,101,108,101,97,115,101,
-100,98,97,110,110,101,114,34,62,112,117,114,99,104,97,115,101,112,111,108,105,99
-,105,101,115,114,101,103,105,111,110,97,108,99,114,101,97,116,105,118,101,97,114
-,103,117,109,101,110,116,98,111,111,107,109,97,114,107,114,101,102,101,114,114,
-101,114,99,104,101,109,105,99,97,108,100,105,118,105,115,105,111,110,99,97,108,
-108,98,97,99,107,115,101,112,97,114,97,116,101,112,114,111,106,101,99,116,115,99
-,111,110,102,108,105,99,116,104,97,114,100,119,97,114,101,105,110,116,101,114,
-101,115,116,100,101,108,105,118,101,114,121,109,111,117,110,116,97,105,110,111,
-98,116,97,105,110,101,100,61,32,102,97,108,115,101,59,102,111,114,40,118,97,114,
-32,97,99,99,101,112,116,101,100,99,97,112,97,99,105,116,121,99,111,109,112,117,
-116,101,114,105,100,101,110,116,105,116,121,97,105,114,99,114,97,102,116,101,109
-,112,108,111,121,101,100,112,114,111,112,111,115,101,100,100,111,109,101,115,116
-,105,99,105,110,99,108,117,100,101,115,112,114,111,118,105,100,101,100,104,111,
-115,112,105,116,97,108,118,101,114,116,105,99,97,108,99,111,108,108,97,112,115,
-101,97,112,112,114,111,97,99,104,112,97,114,116,110,101,114,115,108,111,103,111,
-34,62,60,97,100,97,117,103,104,116,101,114,97,117,116,104,111,114,34,32,99,117,
-108,116,117,114,97,108,102,97,109,105,108,105,101,115,47,105,109,97,103,101,115,
-47,97,115,115,101,109,98,108,121,112,111,119,101,114,102,117,108,116,101,97,99,
-104,105,110,103,102,105,110,105,115,104,101,100,100,105,115,116,114,105,99,116,
-99,114,105,116,105,99,97,108,99,103,105,45,98,105,110,47,112,117,114,112,111,115
-,101,115,114,101,113,117,105,114,101,115,101,108,101,99,116,105,111,110,98,101,
-99,111,109,105,110,103,112,114,111,118,105,100,101,115,97,99,97,100,101,109,105,
-99,101,120,101,114,99,105,115,101,97,99,116,117,97,108,108,121,109,101,100,105,
-99,105,110,101,99,111,110,115,116,97,110,116,97,99,99,105,100,101,110,116,77,97,
-103,97,122,105,110,101,100,111,99,117,109,101,110,116,115,116,97,114,116,105,110
-,103,98,111,116,116,111,109,34,62,111,98,115,101,114,118,101,100,58,32,38,113,
-117,111,116,59,101,120,116,101,110,100,101,100,112,114,101,118,105,111,117,115,
-83,111,102,116,119,97,114,101,99,117,115,116,111,109,101,114,100,101,99,105,115,
-105,111,110,115,116,114,101,110,103,116,104,100,101,116,97,105,108,101,100,115,
-108,105,103,104,116,108,121,112,108,97,110,110,105,110,103,116,101,120,116,97,
-114,101,97,99,117,114,114,101,110,99,121,101,118,101,114,121,111,110,101,115,116
-,114,97,105,103,104,116,116,114,97,110,115,102,101,114,112,111,115,105,116,105,
-118,101,112,114,111,100,117,99,101,100,104,101,114,105,116,97,103,101,115,104,
-105,112,112,105,110,103,97,98,115,111,108,117,116,101,114,101,99,101,105,118,101
-,100,114,101,108,101,118,97,110,116,98,117,116,116,111,110,34,32,118,105,111,108
-,101,110,99,101,97,110,121,119,104,101,114,101,98,101,110,101,102,105,116,115,
-108,97,117,110,99,104,101,100,114,101,99,101,110,116,108,121,97,108,108,105,97,
-110,99,101,102,111,108,108,111,119,101,100,109,117,108,116,105,112,108,101,98,
-117,108,108,101,116,105,110,105,110,99,108,117,100,101,100,111,99,99,117,114,114
-,101,100,105,110,116,101,114,110,97,108,36,40,116,104,105,115,41,46,114,101,112,
-117,98,108,105,99,62,60,116,114,62,60,116,100,99,111,110,103,114,101,115,115,114
-,101,99,111,114,100,101,100,117,108,116,105,109,97,116,101,115,111,108,117,116,
-105,111,110,60,117,108,32,105,100,61,34,100,105,115,99,111,118,101,114,72,111,
-109,101,60,47,97,62,119,101,98,115,105,116,101,115,110,101,116,119,111,114,107,
-115,97,108,116,104,111,117,103,104,101,110,116,105,114,101,108,121,109,101,109,
-111,114,105,97,108,109,101,115,115,97,103,101,115,99,111,110,116,105,110,117,101
-,97,99,116,105,118,101,34,62,115,111,109,101,119,104,97,116,118,105,99,116,111,
-114,105,97,87,101,115,116,101,114,110,32,32,116,105,116,108,101,61,34,76,111,99,
-97,116,105,111,110,99,111,110,116,114,97,99,116,118,105,115,105,116,111,114,115,
-68,111,119,110,108,111,97,100,119,105,116,104,111,117,116,32,114,105,103,104,116
-,34,62,10,109,101,97,115,117,114,101,115,119,105,100,116,104,32,61,32,118,97,114
-,105,97,98,108,101,105,110,118,111,108,118,101,100,118,105,114,103,105,110,105,
-97,110,111,114,109,97,108,108,121,104,97,112,112,101,110,101,100,97,99,99,111,
-117,110,116,115,115,116,97,110,100,105,110,103,110,97,116,105,111,110,97,108,82,
-101,103,105,115,116,101,114,112,114,101,112,97,114,101,100,99,111,110,116,114,
-111,108,115,97,99,99,117,114,97,116,101,98,105,114,116,104,100,97,121,115,116,
-114,97,116,101,103,121,111,102,102,105,99,105,97,108,103,114,97,112,104,105,99,
-115,99,114,105,109,105,110,97,108,112,111,115,115,105,98,108,121,99,111,110,115,
-117,109,101,114,80,101,114,115,111,110,97,108,115,112,101,97,107,105,110,103,118
-,97,108,105,100,97,116,101,97,99,104,105,101,118,101,100,46,106,112,103,34,32,47
-,62,109,97,99,104,105,110,101,115,60,47,104,50,62,10,32,32,107,101,121,119,111,
-114,100,115,102,114,105,101,110,100,108,121,98,114,111,116,104,101,114,115,99,
-111,109,98,105,110,101,100,111,114,105,103,105,110,97,108,99,111,109,112,111,115
-,101,100,101,120,112,101,99,116,101,100,97,100,101,113,117,97,116,101,112,97,107
-,105,115,116,97,110,102,111,108,108,111,119,34,32,118,97,108,117,97,98,108,101,
-60,47,108,97,98,101,108,62,114,101,108,97,116,105,118,101,98,114,105,110,103,105
-,110,103,105,110,99,114,101,97,115,101,103,111,118,101,114,110,111,114,112,108,
-117,103,105,110,115,47,76,105,115,116,32,111,102,32,72,101,97,100,101,114,34,62,
-34,32,110,97,109,101,61,34,32,40,38,113,117,111,116,59,103,114,97,100,117,97,116
-,101,60,47,104,101,97,100,62,10,99,111,109,109,101,114,99,101,109,97,108,97,121,
-115,105,97,100,105,114,101,99,116,111,114,109,97,105,110,116,97,105,110,59,104,
-101,105,103,104,116,58,115,99,104,101,100,117,108,101,99,104,97,110,103,105,110,
-103,98,97,99,107,32,116,111,32,99,97,116,104,111,108,105,99,112,97,116,116,101,
-114,110,115,99,111,108,111,114,58,32,35,103,114,101,97,116,101,115,116,115,117,
-112,112,108,105,101,115,114,101,108,105,97,98,108,101,60,47,117,108,62,10,9,9,60
-,115,101,108,101,99,116,32,99,105,116,105,122,101,110,115,99,108,111,116,104,105
-,110,103,119,97,116,99,104,105,110,103,60,108,105,32,105,100,61,34,115,112,101,
-99,105,102,105,99,99,97,114,114,121,105,110,103,115,101,110,116,101,110,99,101,
-60,99,101,110,116,101,114,62,99,111,110,116,114,97,115,116,116,104,105,110,107,
-105,110,103,99,97,116,99,104,40,101,41,115,111,117,116,104,101,114,110,77,105,99
-,104,97,101,108,32,109,101,114,99,104,97,110,116,99,97,114,111,117,115,101,108,
-112,97,100,100,105,110,103,58,105,110,116,101,114,105,111,114,46,115,112,108,105
-,116,40,34,108,105,122,97,116,105,111,110,79,99,116,111,98,101,114,32,41,123,114
-,101,116,117,114,110,105,109,112,114,111,118,101,100,45,45,38,103,116,59,10,10,
-99,111,118,101,114,97,103,101,99,104,97,105,114,109,97,110,46,112,110,103,34,32,
-47,62,115,117,98,106,101,99,116,115,82,105,99,104,97,114,100,32,119,104,97,116,
-101,118,101,114,112,114,111,98,97,98,108,121,114,101,99,111,118,101,114,121,98,
-97,115,101,98,97,108,108,106,117,100,103,109,101,110,116,99,111,110,110,101,99,
-116,46,46,99,115,115,34,32,47,62,32,119,101,98,115,105,116,101,114,101,112,111,
-114,116,101,100,100,101,102,97,117,108,116,34,47,62,60,47,97,62,13,10,101,108,
-101,99,116,114,105,99,115,99,111,116,108,97,110,100,99,114,101,97,116,105,111,
-110,113,117,97,110,116,105,116,121,46,32,73,83,66,78,32,48,100,105,100,32,110,
-111,116,32,105,110,115,116,97,110,99,101,45,115,101,97,114,99,104,45,34,32,108,
-97,110,103,61,34,115,112,101,97,107,101,114,115,67,111,109,112,117,116,101,114,
-99,111,110,116,97,105,110,115,97,114,99,104,105,118,101,115,109,105,110,105,115,
-116,101,114,114,101,97,99,116,105,111,110,100,105,115,99,111,117,110,116,73,116,
-97,108,105,97,110,111,99,114,105,116,101,114,105,97,115,116,114,111,110,103,108,
-121,58,32,39,104,116,116,112,58,39,115,99,114,105,112,116,39,99,111,118,101,114,
-105,110,103,111,102,102,101,114,105,110,103,97,112,112,101,97,114,101,100,66,114
-,105,116,105,115,104,32,105,100,101,110,116,105,102,121,70,97,99,101,98,111,111,
-107,110,117,109,101,114,111,117,115,118,101,104,105,99,108,101,115,99,111,110,99
-,101,114,110,115,65,109,101,114,105,99,97,110,104,97,110,100,108,105,110,103,100
-,105,118,32,105,100,61,34,87,105,108,108,105,97,109,32,112,114,111,118,105,100,
-101,114,95,99,111,110,116,101,110,116,97,99,99,117,114,97,99,121,115,101,99,116,
-105,111,110,32,97,110,100,101,114,115,111,110,102,108,101,120,105,98,108,101,67,
-97,116,101,103,111,114,121,108,97,119,114,101,110,99,101,60,115,99,114,105,112,
-116,62,108,97,121,111,117,116,61,34,97,112,112,114,111,118,101,100,32,109,97,120
-,105,109,117,109,104,101,97,100,101,114,34,62,60,47,116,97,98,108,101,62,83,101,
-114,118,105,99,101,115,104,97,109,105,108,116,111,110,99,117,114,114,101,110,116
-,32,99,97,110,97,100,105,97,110,99,104,97,110,110,101,108,115,47,116,104,101,109
-,101,115,47,47,97,114,116,105,99,108,101,111,112,116,105,111,110,97,108,112,111,
-114,116,117,103,97,108,118,97,108,117,101,61,34,34,105,110,116,101,114,118,97,
-108,119,105,114,101,108,101,115,115,101,110,116,105,116,108,101,100,97,103,101,
-110,99,105,101,115,83,101,97,114,99,104,34,32,109,101,97,115,117,114,101,100,116
-,104,111,117,115,97,110,100,115,112,101,110,100,105,110,103,38,104,101,108,108,
-105,112,59,110,101,119,32,68,97,116,101,34,32,115,105,122,101,61,34,112,97,103,
-101,78,97,109,101,109,105,100,100,108,101,34,32,34,32,47,62,60,47,97,62,104,105,
-100,100,101,110,34,62,115,101,113,117,101,110,99,101,112,101,114,115,111,110,97,
-108,111,118,101,114,102,108,111,119,111,112,105,110,105,111,110,115,105,108,108,
-105,110,111,105,115,108,105,110,107,115,34,62,10,9,60,116,105,116,108,101,62,118
-,101,114,115,105,111,110,115,115,97,116,117,114,100,97,121,116,101,114,109,105,
-110,97,108,105,116,101,109,112,114,111,112,101,110,103,105,110,101,101,114,115,
-101,99,116,105,111,110,115,100,101,115,105,103,110,101,114,112,114,111,112,111,
-115,97,108,61,34,102,97,108,115,101,34,69,115,112,97,195,177,111,108,114,101,108
-,101,97,115,101,115,115,117,98,109,105,116,34,32,101,114,38,113,117,111,116,59,
-97,100,100,105,116,105,111,110,115,121,109,112,116,111,109,115,111,114,105,101,
-110,116,101,100,114,101,115,111,117,114,99,101,114,105,103,104,116,34,62,60,112,
-108,101,97,115,117,114,101,115,116,97,116,105,111,110,115,104,105,115,116,111,
-114,121,46,108,101,97,118,105,110,103,32,32,98,111,114,100,101,114,61,99,111,110
-,116,101,110,116,115,99,101,110,116,101,114,34,62,46,10,10,83,111,109,101,32,100
-,105,114,101,99,116,101,100,115,117,105,116,97,98,108,101,98,117,108,103,97,114,
-105,97,46,115,104,111,119,40,41,59,100,101,115,105,103,110,101,100,71,101,110,
-101,114,97,108,32,99,111,110,99,101,112,116,115,69,120,97,109,112,108,101,115,
-119,105,108,108,105,97,109,115,79,114,105,103,105,110,97,108,34,62,60,115,112,97
-,110,62,115,101,97,114,99,104,34,62,111,112,101,114,97,116,111,114,114,101,113,
-117,101,115,116,115,97,32,38,113,117,111,116,59,97,108,108,111,119,105,110,103,
-68,111,99,117,109,101,110,116,114,101,118,105,115,105,111,110,46,32,10,10,84,104
-,101,32,121,111,117,114,115,101,108,102,67,111,110,116,97,99,116,32,109,105,99,
-104,105,103,97,110,69,110,103,108,105,115,104,32,99,111,108,117,109,98,105,97,
-112,114,105,111,114,105,116,121,112,114,105,110,116,105,110,103,100,114,105,110,
-107,105,110,103,102,97,99,105,108,105,116,121,114,101,116,117,114,110,101,100,67
-,111,110,116,101,110,116,32,111,102,102,105,99,101,114,115,82,117,115,115,105,97
-,110,32,103,101,110,101,114,97,116,101,45,56,56,53,57,45,49,34,105,110,100,105,
-99,97,116,101,102,97,109,105,108,105,97,114,32,113,117,97,108,105,116,121,109,97
-,114,103,105,110,58,48,32,99,111,110,116,101,110,116,118,105,101,119,112,111,114
-,116,99,111,110,116,97,99,116,115,45,116,105,116,108,101,34,62,112,111,114,116,
-97,98,108,101,46,108,101,110,103,116,104,32,101,108,105,103,105,98,108,101,105,
-110,118,111,108,118,101,115,97,116,108,97,110,116,105,99,111,110,108,111,97,100,
-61,34,100,101,102,97,117,108,116,46,115,117,112,112,108,105,101,100,112,97,121,
-109,101,110,116,115,103,108,111,115,115,97,114,121,10,10,65,102,116,101,114,32,
-103,117,105,100,97,110,99,101,60,47,116,100,62,60,116,100,101,110,99,111,100,105
-,110,103,109,105,100,100,108,101,34,62,99,97,109,101,32,116,111,32,100,105,115,
-112,108,97,121,115,115,99,111,116,116,105,115,104,106,111,110,97,116,104,97,110,
-109,97,106,111,114,105,116,121,119,105,100,103,101,116,115,46,99,108,105,110,105
-,99,97,108,116,104,97,105,108,97,110,100,116,101,97,99,104,101,114,115,60,104,
-101,97,100,62,10,9,97,102,102,101,99,116,101,100,115,117,112,112,111,114,116,115
-,112,111,105,110,116,101,114,59,116,111,83,116,114,105,110,103,60,47,115,109,97,
-108,108,62,111,107,108,97,104,111,109,97,119,105,108,108,32,98,101,32,105,110,
-118,101,115,116,111,114,48,34,32,97,108,116,61,34,104,111,108,105,100,97,121,115
-,82,101,115,111,117,114,99,101,108,105,99,101,110,115,101,100,32,40,119,104,105,
-99,104,32,46,32,65,102,116,101,114,32,99,111,110,115,105,100,101,114,118,105,115
-,105,116,105,110,103,101,120,112,108,111,114,101,114,112,114,105,109,97,114,121,
-32,115,101,97,114,99,104,34,32,97,110,100,114,111,105,100,34,113,117,105,99,107,
-108,121,32,109,101,101,116,105,110,103,115,101,115,116,105,109,97,116,101,59,114
-,101,116,117,114,110,32,59,99,111,108,111,114,58,35,32,104,101,105,103,104,116,
-61,97,112,112,114,111,118,97,108,44,32,38,113,117,111,116,59,32,99,104,101,99,
-107,101,100,46,109,105,110,46,106,115,34,109,97,103,110,101,116,105,99,62,60,47,
-97,62,60,47,104,102,111,114,101,99,97,115,116,46,32,87,104,105,108,101,32,116,
-104,117,114,115,100,97,121,100,118,101,114,116,105,115,101,38,101,97,99,117,116,
-101,59,104,97,115,67,108,97,115,115,101,118,97,108,117,97,116,101,111,114,100,
-101,114,105,110,103,101,120,105,115,116,105,110,103,112,97,116,105,101,110,116,
-115,32,79,110,108,105,110,101,32,99,111,108,111,114,97,100,111,79,112,116,105,
-111,110,115,34,99,97,109,112,98,101,108,108,60,33,45,45,32,101,110,100,60,47,115
-,112,97,110,62,60,60,98,114,32,47,62,13,10,95,112,111,112,117,112,115,124,115,99
-,105,101,110,99,101,115,44,38,113,117,111,116,59,32,113,117,97,108,105,116,121,
-32,87,105,110,100,111,119,115,32,97,115,115,105,103,110,101,100,104,101,105,103,
-104,116,58,32,60,98,32,99,108,97,115,115,108,101,38,113,117,111,116,59,32,118,97
-,108,117,101,61,34,32,67,111,109,112,97,110,121,101,120,97,109,112,108,101,115,
-60,105,102,114,97,109,101,32,98,101,108,105,101,118,101,115,112,114,101,115,101,
-110,116,115,109,97,114,115,104,97,108,108,112,97,114,116,32,111,102,32,112,114,
-111,112,101,114,108,121,41,46,10,10,84,104,101,32,116,97,120,111,110,111,109,121
-,109,117,99,104,32,111,102,32,60,47,115,112,97,110,62,10,34,32,100,97,116,97,45,
-115,114,116,117,103,117,195,170,115,115,99,114,111,108,108,84,111,32,112,114,111
-,106,101,99,116,60,104,101,97,100,62,13,10,97,116,116,111,114,110,101,121,101,
-109,112,104,97,115,105,115,115,112,111,110,115,111,114,115,102,97,110,99,121,98,
-111,120,119,111,114,108,100,39,115,32,119,105,108,100,108,105,102,101,99,104,101
-,99,107,101,100,61,115,101,115,115,105,111,110,115,112,114,111,103,114,97,109,
-109,112,120,59,102,111,110,116,45,32,80,114,111,106,101,99,116,106,111,117,114,
-110,97,108,115,98,101,108,105,101,118,101,100,118,97,99,97,116,105,111,110,116,
-104,111,109,112,115,111,110,108,105,103,104,116,105,110,103,97,110,100,32,116,
-104,101,32,115,112,101,99,105,97,108,32,98,111,114,100,101,114,61,48,99,104,101,
-99,107,105,110,103,60,47,116,98,111,100,121,62,60,98,117,116,116,111,110,32,67,
-111,109,112,108,101,116,101,99,108,101,97,114,102,105,120,10,60,104,101,97,100,
-62,10,97,114,116,105,99,108,101,32,60,115,101,99,116,105,111,110,102,105,110,100
-,105,110,103,115,114,111,108,101,32,105,110,32,112,111,112,117,108,97,114,32,32,
-79,99,116,111,98,101,114,119,101,98,115,105,116,101,32,101,120,112,111,115,117,
-114,101,117,115,101,100,32,116,111,32,32,99,104,97,110,103,101,115,111,112,101,
-114,97,116,101,100,99,108,105,99,107,105,110,103,101,110,116,101,114,105,110,103
-,99,111,109,109,97,110,100,115,105,110,102,111,114,109,101,100,32,110,117,109,98
-,101,114,115,32,32,60,47,100,105,118,62,99,114,101,97,116,105,110,103,111,110,83
-,117,98,109,105,116,109,97,114,121,108,97,110,100,99,111,108,108,101,103,101,115
-,97,110,97,108,121,116,105,99,108,105,115,116,105,110,103,115,99,111,110,116,97,
-99,116,46,108,111,103,103,101,100,73,110,97,100,118,105,115,111,114,121,115,105,
-98,108,105,110,103,115,99,111,110,116,101,110,116,34,115,38,113,117,111,116,59,
-41,115,46,32,84,104,105,115,32,112,97,99,107,97,103,101,115,99,104,101,99,107,98
-,111,120,115,117,103,103,101,115,116,115,112,114,101,103,110,97,110,116,116,111,
-109,111,114,114,111,119,115,112,97,99,105,110,103,61,105,99,111,110,46,112,110,
-103,106,97,112,97,110,101,115,101,99,111,100,101,98,97,115,101,98,117,116,116,
-111,110,34,62,103,97,109,98,108,105,110,103,115,117,99,104,32,97,115,32,44,32,
-119,104,105,108,101,32,60,47,115,112,97,110,62,32,109,105,115,115,111,117,114,
-105,115,112,111,114,116,105,110,103,116,111,112,58,49,112,120,32,46,60,47,115,
-112,97,110,62,116,101,110,115,105,111,110,115,119,105,100,116,104,61,34,50,108,
-97,122,121,108,111,97,100,110,111,118,101,109,98,101,114,117,115,101,100,32,105,
-110,32,104,101,105,103,104,116,61,34,99,114,105,112,116,34,62,10,38,110,98,115,
-112,59,60,47,60,116,114,62,60,116,100,32,104,101,105,103,104,116,58,50,47,112,
-114,111,100,117,99,116,99,111,117,110,116,114,121,32,105,110,99,108,117,100,101,
-32,102,111,111,116,101,114,34,32,38,108,116,59,33,45,45,32,116,105,116,108,101,
-34,62,60,47,106,113,117,101,114,121,46,60,47,102,111,114,109,62,10,40,231,174,
-128,228,189,147,41,40,231,185,129,233,171,148,41,104,114,118,97,116,115,107,105,
-105,116,97,108,105,97,110,111,114,111,109,195,162,110,196,131,116,195,188,114,
-107,195,167,101,216,167,216,177,216,175,217,136,116,97,109,98,105,195,169,110,
-110,111,116,105,99,105,97,115,109,101,110,115,97,106,101,115,112,101,114,115,111
-,110,97,115,100,101,114,101,99,104,111,115,110,97,99,105,111,110,97,108,115,101,
-114,118,105,99,105,111,99,111,110,116,97,99,116,111,117,115,117,97,114,105,111,
-115,112,114,111,103,114,97,109,97,103,111,98,105,101,114,110,111,101,109,112,114
-,101,115,97,115,97,110,117,110,99,105,111,115,118,97,108,101,110,99,105,97,99,
-111,108,111,109,98,105,97,100,101,115,112,117,195,169,115,100,101,112,111,114,
-116,101,115,112,114,111,121,101,99,116,111,112,114,111,100,117,99,116,111,112,
-195,186,98,108,105,99,111,110,111,115,111,116,114,111,115,104,105,115,116,111,
-114,105,97,112,114,101,115,101,110,116,101,109,105,108,108,111,110,101,115,109,
-101,100,105,97,110,116,101,112,114,101,103,117,110,116,97,97,110,116,101,114,105
-,111,114,114,101,99,117,114,115,111,115,112,114,111,98,108,101,109,97,115,97,110
-,116,105,97,103,111,110,117,101,115,116,114,111,115,111,112,105,110,105,195,179,
-110,105,109,112,114,105,109,105,114,109,105,101,110,116,114,97,115,97,109,195,
-169,114,105,99,97,118,101,110,100,101,100,111,114,115,111,99,105,101,100,97,100,
-114,101,115,112,101,99,116,111,114,101,97,108,105,122,97,114,114,101,103,105,115
-,116,114,111,112,97,108,97,98,114,97,115,105,110,116,101,114,195,169,115,101,110
-,116,111,110,99,101,115,101,115,112,101,99,105,97,108,109,105,101,109,98,114,111
-,115,114,101,97,108,105,100,97,100,99,195,179,114,100,111,98,97,122,97,114,97,
-103,111,122,97,112,195,161,103,105,110,97,115,115,111,99,105,97,108,101,115,98,
-108,111,113,117,101,97,114,103,101,115,116,105,195,179,110,97,108,113,117,105,
-108,101,114,115,105,115,116,101,109,97,115,99,105,101,110,99,105,97,115,99,111,
-109,112,108,101,116,111,118,101,114,115,105,195,179,110,99,111,109,112,108,101,
-116,97,101,115,116,117,100,105,111,115,112,195,186,98,108,105,99,97,111,98,106,
-101,116,105,118,111,97,108,105,99,97,110,116,101,98,117,115,99,97,100,111,114,99
-,97,110,116,105,100,97,100,101,110,116,114,97,100,97,115,97,99,99,105,111,110,
-101,115,97,114,99,104,105,118,111,115,115,117,112,101,114,105,111,114,109,97,121
-,111,114,195,173,97,97,108,101,109,97,110,105,97,102,117,110,99,105,195,179,110,
-195,186,108,116,105,109,111,115,104,97,99,105,101,110,100,111,97,113,117,101,108
-,108,111,115,101,100,105,99,105,195,179,110,102,101,114,110,97,110,100,111,97,
-109,98,105,101,110,116,101,102,97,99,101,98,111,111,107,110,117,101,115,116,114,
-97,115,99,108,105,101,110,116,101,115,112,114,111,99,101,115,111,115,98,97,115,
-116,97,110,116,101,112,114,101,115,101,110,116,97,114,101,112,111,114,116,97,114
-,99,111,110,103,114,101,115,111,112,117,98,108,105,99,97,114,99,111,109,101,114,
-99,105,111,99,111,110,116,114,97,116,111,106,195,179,118,101,110,101,115,100,105
-,115,116,114,105,116,111,116,195,169,99,110,105,99,97,99,111,110,106,117,110,116
-,111,101,110,101,114,103,195,173,97,116,114,97,98,97,106,97,114,97,115,116,117,
-114,105,97,115,114,101,99,105,101,110,116,101,117,116,105,108,105,122,97,114,98,
-111,108,101,116,195,173,110,115,97,108,118,97,100,111,114,99,111,114,114,101,99,
-116,97,116,114,97,98,97,106,111,115,112,114,105,109,101,114,111,115,110,101,103,
-111,99,105,111,115,108,105,98,101,114,116,97,100,100,101,116,97,108,108,101,115,
-112,97,110,116,97,108,108,97,112,114,195,179,120,105,109,111,97,108,109,101,114,
-195,173,97,97,110,105,109,97,108,101,115,113,117,105,195,169,110,101,115,99,111,
-114,97,122,195,179,110,115,101,99,99,105,195,179,110,98,117,115,99,97,110,100,
-111,111,112,99,105,111,110,101,115,101,120,116,101,114,105,111,114,99,111,110,99
-,101,112,116,111,116,111,100,97,118,195,173,97,103,97,108,101,114,195,173,97,101
-,115,99,114,105,98,105,114,109,101,100,105,99,105,110,97,108,105,99,101,110,99,
-105,97,99,111,110,115,117,108,116,97,97,115,112,101,99,116,111,115,99,114,195,
-173,116,105,99,97,100,195,179,108,97,114,101,115,106,117,115,116,105,99,105,97,
-100,101,98,101,114,195,161,110,112,101,114,195,173,111,100,111,110,101,99,101,
-115,105,116,97,109,97,110,116,101,110,101,114,112,101,113,117,101,195,177,111,
-114,101,99,105,98,105,100,97,116,114,105,98,117,110,97,108,116,101,110,101,114,
-105,102,101,99,97,110,99,105,195,179,110,99,97,110,97,114,105,97,115,100,101,115
-,99,97,114,103,97,100,105,118,101,114,115,111,115,109,97,108,108,111,114,99,97,
-114,101,113,117,105,101,114,101,116,195,169,99,110,105,99,111,100,101,98,101,114
-,195,173,97,118,105,118,105,101,110,100,97,102,105,110,97,110,122,97,115,97,100,
-101,108,97,110,116,101,102,117,110,99,105,111,110,97,99,111,110,115,101,106,111,
-115,100,105,102,195,173,99,105,108,99,105,117,100,97,100,101,115,97,110,116,105,
-103,117,97,115,97,118,97,110,122,97,100,97,116,195,169,114,109,105,110,111,117,
-110,105,100,97,100,101,115,115,195,161,110,99,104,101,122,99,97,109,112,97,195,
-177,97,115,111,102,116,111,110,105,99,114,101,118,105,115,116,97,115,99,111,110,
-116,105,101,110,101,115,101,99,116,111,114,101,115,109,111,109,101,110,116,111,
-115,102,97,99,117,108,116,97,100,99,114,195,169,100,105,116,111,100,105,118,101,
-114,115,97,115,115,117,112,117,101,115,116,111,102,97,99,116,111,114,101,115,115
-,101,103,117,110,100,111,115,112,101,113,117,101,195,177,97,208,179,208,190,208,
-180,208,176,208,181,209,129,208,187,208,184,208,181,209,129,209,130,209,140,208,
-177,209,139,208,187,208,190,208,177,209,139,209,130,209,140,209,141,209,130,208,
-190,208,188,208,149,209,129,208,187,208,184,209,130,208,190,208,179,208,190,208,
-188,208,181,208,189,209,143,208,178,209,129,208,181,209,133,209,141,209,130,208,
-190,208,185,208,180,208,176,208,182,208,181,208,177,209,139,208,187,208,184,208,
-179,208,190,208,180,209,131,208,180,208,181,208,189,209,140,209,141,209,130,208,
-190,209,130,208,177,209,139,208,187,208,176,209,129,208,181,208,177,209,143,208,
-190,208,180,208,184,208,189,209,129,208,181,208,177,208,181,208,189,208,176,208,
-180,208,190,209,129,208,176,208,185,209,130,209,132,208,190,209,130,208,190,208,
-189,208,181,208,179,208,190,209,129,208,178,208,190,208,184,209,129,208,178,208,
-190,208,185,208,184,208,179,209,128,209,139,209,130,208,190,208,182,208,181,208,
-178,209,129,208,181,208,188,209,129,208,178,208,190,209,142,208,187,208,184,209,
-136,209,140,209,141,209,130,208,184,209,133,208,191,208,190,208,186,208,176,208,
-180,208,189,208,181,208,185,208,180,208,190,208,188,208,176,208,188,208,184,209,
-128,208,176,208,187,208,184,208,177,208,190,209,130,208,181,208,188,209,131,209,
-133,208,190,209,130,209,143,208,180,208,178,209,131,209,133,209,129,208,181,209,
-130,208,184,208,187,209,142,208,180,208,184,208,180,208,181,208,187,208,190,208,
-188,208,184,209,128,208,181,209,130,208,181,208,177,209,143,209,129,208,178,208,
-190,208,181,208,178,208,184,208,180,208,181,209,135,208,181,208,179,208,190,209,
-141,209,130,208,184,208,188,209,129,209,135,208,181,209,130,209,130,208,181,208,
-188,209,139,209,134,208,181,208,189,209,139,209,129,209,130,208,176,208,187,208,
-178,208,181,208,180,209,140,209,130,208,181,208,188,208,181,208,178,208,190,208,
-180,209,139,209,130,208,181,208,177,208,181,208,178,209,139,209,136,208,181,208,
-189,208,176,208,188,208,184,209,130,208,184,208,191,208,176,209,130,208,190,208,
-188,209,131,208,191,209,128,208,176,208,178,208,187,208,184,209,134,208,176,208,
-190,208,180,208,189,208,176,208,179,208,190,208,180,209,139,208,183,208,189,208,
-176,209,142,208,188,208,190,208,179,209,131,208,180,209,128,209,131,208,179,208,
-178,209,129,208,181,208,185,208,184,208,180,208,181,209,130,208,186,208,184,208,
-189,208,190,208,190,208,180,208,189,208,190,208,180,208,181,208,187,208,176,208,
-180,208,181,208,187,208,181,209,129,209,128,208,190,208,186,208,184,209,142,208,
-189,209,143,208,178,208,181,209,129,209,140,208,149,209,129,209,130,209,140,209,
-128,208,176,208,183,208,176,208,189,208,176,209,136,208,184,216,167,217,132,217,
-132,217,135,216,167,217,132,216,170,217,138,216,172,217,133,217,138,216,185,216,
-174,216,167,216,181,216,169,216,167,217,132,216,176,217,138,216,185,217,132,217,
-138,217,135,216,172,216,175,217,138,216,175,216,167,217,132,216,162,217,134,216,
-167,217,132,216,177,216,175,216,170,216,173,217,131,217,133,216,181,217,129,216,
-173,216,169,217,131,216,167,217,134,216,170,216,167,217,132,217,132,217,138,217,
-138,217,131,217,136,217,134,216,180,216,168,217,131,216,169,217,129,217,138,217,
-135,216,167,216,168,217,134,216,167,216,170,216,173,217,136,216,167,216,161,216,
-163,217,131,216,171,216,177,216,174,217,132,216,167,217,132,216,167,217,132,216,
-173,216,168,216,175,217,132,217,138,217,132,216,175,216,177,217,136,216,179,216,
-167,216,182,216,186,216,183,216,170,217,131,217,136,217,134,217,135,217,134,216,
-167,217,131,216,179,216,167,216,173,216,169,217,134,216,167,216,175,217,138,216,
-167,217,132,216,183,216,168,216,185,217,132,217,138,217,131,216,180,217,131,216,
-177,216,167,217,138,217,133,217,131,217,134,217,133,217,134,217,135,216,167,216,
-180,216,177,217,131,216,169,216,177,216,166,217,138,216,179,217,134,216,180,217,
-138,216,183,217,133,216,167,216,176,216,167,216,167,217,132,217,129,217,134,216,
-180,216,168,216,167,216,168,216,170,216,185,216,168,216,177,216,177,216,173,217,
-133,216,169,217,131,216,167,217,129,216,169,217,138,217,130,217,136,217,132,217,
-133,216,177,217,131,216,178,217,131,217,132,217,133,216,169,216,163,216,173,217,
-133,216,175,217,130,217,132,216,168,217,138,217,138,216,185,217,134,217,138,216,
-181,217,136,216,177,216,169,216,183,216,177,217,138,217,130,216,180,216,167,216,
-177,217,131,216,172,217,136,216,167,217,132,216,163,216,174,216,177,217,137,217,
-133,216,185,217,134,216,167,216,167,216,168,216,173,216,171,216,185,216,177,217,
-136,216,182,216,168,216,180,217,131,217,132,217,133,216,179,216,172,217,132,216,
-168,217,134,216,167,217,134,216,174,216,167,217,132,216,175,217,131,216,170,216,
-167,216,168,217,131,217,132,217,138,216,169,216,168,216,175,217,136,217,134,216,
-163,217,138,216,182,216,167,217,138,217,136,216,172,216,175,217,129,216,177,217,
-138,217,130,217,131,216,170,216,168,216,170,216,163,217,129,216,182,217,132,217,
-133,216,183,216,168,216,174,216,167,217,131,216,171,216,177,216,168,216,167,216,
-177,217,131,216,167,217,129,216,182,217,132,216,167,216,173,217,132,217,137,217,
-134,217,129,216,179,217,135,216,163,217,138,216,167,217,133,216,177,216,175,217,
-136,216,175,216,163,217,134,217,135,216,167,216,175,217,138,217,134,216,167,216,
-167,217,132,216,167,217,134,217,133,216,185,216,177,216,182,216,170,216,185,217,
-132,217,133,216,175,216,167,216,174,217,132,217,133,217,133,217,131,217,134,0,0,
-0,0,0,0,0,0,1,0,1,0,1,0,1,0,2,0,2,0,2,0,2,0,4,0,4,0,4,0,4,0,0,1,2,3,4,5,6,7,7,6,
-5,4,3,2,1,0,8,9,10,11,12,13,14,15,15,14,13,12,11,10,9,8,16,17,18,19,20,21,22,23,
-23,22,21,20,19,18,17,16,24,25,26,27,28,29,30,31,31,30,29,28,27,26,25,24,255,255,
-255,255,0,0,0,0,0,0,0,0,255,255,255,255,1,0,0,0,2,0,0,0,2,0,0,0,1,0,0,0,1,0,0,0,
-3,0,0,0,255,255,0,1,0,0,0,1,0,0,255,255,0,1,0,0,0,8,0,8,0,8,0,8,0,0,0,1,0,2,0,3,
-0,4,0,5,0,6,0,7,114,101,115,111,117,114,99,101,115,99,111,117,110,116,114,105,
-101,115,113,117,101,115,116,105,111,110,115,101,113,117,105,112,109,101,110,116,
-99,111,109,109,117,110,105,116,121,97,118,97,105,108,97,98,108,101,104,105,103,
-104,108,105,103,104,116,68,84,68,47,120,104,116,109,108,109,97,114,107,101,116,
-105,110,103,107,110,111,119,108,101,100,103,101,115,111,109,101,116,104,105,110,
-103,99,111,110,116,97,105,110,101,114,100,105,114,101,99,116,105,111,110,115,117
-,98,115,99,114,105,98,101,97,100,118,101,114,116,105,115,101,99,104,97,114,97,99
-,116,101,114,34,32,118,97,108,117,101,61,34,60,47,115,101,108,101,99,116,62,65,
-117,115,116,114,97,108,105,97,34,32,99,108,97,115,115,61,34,115,105,116,117,97,
-116,105,111,110,97,117,116,104,111,114,105,116,121,102,111,108,108,111,119,105,
-110,103,112,114,105,109,97,114,105,108,121,111,112,101,114,97,116,105,111,110,99
-,104,97,108,108,101,110,103,101,100,101,118,101,108,111,112,101,100,97,110,111,
-110,121,109,111,117,115,102,117,110,99,116,105,111,110,32,102,117,110,99,116,105
-,111,110,115,99,111,109,112,97,110,105,101,115,115,116,114,117,99,116,117,114,
-101,97,103,114,101,101,109,101,110,116,34,32,116,105,116,108,101,61,34,112,111,
-116,101,110,116,105,97,108,101,100,117,99,97,116,105,111,110,97,114,103,117,109,
-101,110,116,115,115,101,99,111,110,100,97,114,121,99,111,112,121,114,105,103,104
-,116,108,97,110,103,117,97,103,101,115,101,120,99,108,117,115,105,118,101,99,111
-,110,100,105,116,105,111,110,60,47,102,111,114,109,62,13,10,115,116,97,116,101,
-109,101,110,116,97,116,116,101,110,116,105,111,110,66,105,111,103,114,97,112,104
-,121,125,32,101,108,115,101,32,123,10,115,111,108,117,116,105,111,110,115,119,
-104,101,110,32,116,104,101,32,65,110,97,108,121,116,105,99,115,116,101,109,112,
-108,97,116,101,115,100,97,110,103,101,114,111,117,115,115,97,116,101,108,108,105
-,116,101,100,111,99,117,109,101,110,116,115,112,117,98,108,105,115,104,101,114,
-105,109,112,111,114,116,97,110,116,112,114,111,116,111,116,121,112,101,105,110,
-102,108,117,101,110,99,101,38,114,97,113,117,111,59,60,47,101,102,102,101,99,116
-,105,118,101,103,101,110,101,114,97,108,108,121,116,114,97,110,115,102,111,114,
-109,98,101,97,117,116,105,102,117,108,116,114,97,110,115,112,111,114,116,111,114
-,103,97,110,105,122,101,100,112,117,98,108,105,115,104,101,100,112,114,111,109,
-105,110,101,110,116,117,110,116,105,108,32,116,104,101,116,104,117,109,98,110,97
-,105,108,78,97,116,105,111,110,97,108,32,46,102,111,99,117,115,40,41,59,111,118,
-101,114,32,116,104,101,32,109,105,103,114,97,116,105,111,110,97,110,110,111,117,
-110,99,101,100,102,111,111,116,101,114,34,62,10,101,120,99,101,112,116,105,111,
-110,108,101,115,115,32,116,104,97,110,101,120,112,101,110,115,105,118,101,102,
-111,114,109,97,116,105,111,110,102,114,97,109,101,119,111,114,107,116,101,114,
-114,105,116,111,114,121,110,100,105,99,97,116,105,111,110,99,117,114,114,101,110
-,116,108,121,99,108,97,115,115,78,97,109,101,99,114,105,116,105,99,105,115,109,
-116,114,97,100,105,116,105,111,110,101,108,115,101,119,104,101,114,101,65,108,
-101,120,97,110,100,101,114,97,112,112,111,105,110,116,101,100,109,97,116,101,114
-,105,97,108,115,98,114,111,97,100,99,97,115,116,109,101,110,116,105,111,110,101,
-100,97,102,102,105,108,105,97,116,101,60,47,111,112,116,105,111,110,62,116,114,
-101,97,116,109,101,110,116,100,105,102,102,101,114,101,110,116,47,100,101,102,97
-,117,108,116,46,80,114,101,115,105,100,101,110,116,111,110,99,108,105,99,107,61,
-34,98,105,111,103,114,97,112,104,121,111,116,104,101,114,119,105,115,101,112,101
-,114,109,97,110,101,110,116,70,114,97,110,195,167,97,105,115,72,111,108,108,121,
-119,111,111,100,101,120,112,97,110,115,105,111,110,115,116,97,110,100,97,114,100
-,115,60,47,115,116,121,108,101,62,10,114,101,100,117,99,116,105,111,110,68,101,
-99,101,109,98,101,114,32,112,114,101,102,101,114,114,101,100,67,97,109,98,114,
-105,100,103,101,111,112,112,111,110,101,110,116,115,66,117,115,105,110,101,115,
-115,32,99,111,110,102,117,115,105,111,110,62,10,60,116,105,116,108,101,62,112,
-114,101,115,101,110,116,101,100,101,120,112,108,97,105,110,101,100,100,111,101,
-115,32,110,111,116,32,119,111,114,108,100,119,105,100,101,105,110,116,101,114,
-102,97,99,101,112,111,115,105,116,105,111,110,115,110,101,119,115,112,97,112,101
-,114,60,47,116,97,98,108,101,62,10,109,111,117,110,116,97,105,110,115,108,105,
-107,101,32,116,104,101,32,101,115,115,101,110,116,105,97,108,102,105,110,97,110,
-99,105,97,108,115,101,108,101,99,116,105,111,110,97,99,116,105,111,110,61,34,47,
-97,98,97,110,100,111,110,101,100,69,100,117,99,97,116,105,111,110,112,97,114,115
-,101,73,110,116,40,115,116,97,98,105,108,105,116,121,117,110,97,98,108,101,32,
-116,111,60,47,116,105,116,108,101,62,10,114,101,108,97,116,105,111,110,115,78,
-111,116,101,32,116,104,97,116,101,102,102,105,99,105,101,110,116,112,101,114,102
-,111,114,109,101,100,116,119,111,32,121,101,97,114,115,83,105,110,99,101,32,116,
-104,101,116,104,101,114,101,102,111,114,101,119,114,97,112,112,101,114,34,62,97,
-108,116,101,114,110,97,116,101,105,110,99,114,101,97,115,101,100,66,97,116,116,
-108,101,32,111,102,112,101,114,99,101,105,118,101,100,116,114,121,105,110,103,32
-,116,111,110,101,99,101,115,115,97,114,121,112,111,114,116,114,97,121,101,100,
-101,108,101,99,116,105,111,110,115,69,108,105,122,97,98,101,116,104,60,47,105,
-102,114,97,109,101,62,100,105,115,99,111,118,101,114,121,105,110,115,117,114,97,
-110,99,101,115,46,108,101,110,103,116,104,59,108,101,103,101,110,100,97,114,121,
-71,101,111,103,114,97,112,104,121,99,97,110,100,105,100,97,116,101,99,111,114,
-112,111,114,97,116,101,115,111,109,101,116,105,109,101,115,115,101,114,118,105,
-99,101,115,46,105,110,104,101,114,105,116,101,100,60,47,115,116,114,111,110,103,
-62,67,111,109,109,117,110,105,116,121,114,101,108,105,103,105,111,117,115,108,
-111,99,97,116,105,111,110,115,67,111,109,109,105,116,116,101,101,98,117,105,108,
-100,105,110,103,115,116,104,101,32,119,111,114,108,100,110,111,32,108,111,110,
-103,101,114,98,101,103,105,110,110,105,110,103,114,101,102,101,114,101,110,99,
-101,99,97,110,110,111,116,32,98,101,102,114,101,113,117,101,110,99,121,116,121,
-112,105,99,97,108,108,121,105,110,116,111,32,116,104,101,32,114,101,108,97,116,
-105,118,101,59,114,101,99,111,114,100,105,110,103,112,114,101,115,105,100,101,
-110,116,105,110,105,116,105,97,108,108,121,116,101,99,104,110,105,113,117,101,
-116,104,101,32,111,116,104,101,114,105,116,32,99,97,110,32,98,101,101,120,105,
-115,116,101,110,99,101,117,110,100,101,114,108,105,110,101,116,104,105,115,32,
-116,105,109,101,116,101,108,101,112,104,111,110,101,105,116,101,109,115,99,111,
-112,101,112,114,97,99,116,105,99,101,115,97,100,118,97,110,116,97,103,101,41,59,
-114,101,116,117,114,110,32,70,111,114,32,111,116,104,101,114,112,114,111,118,105
-,100,105,110,103,100,101,109,111,99,114,97,99,121,98,111,116,104,32,116,104,101,
-32,101,120,116,101,110,115,105,118,101,115,117,102,102,101,114,105,110,103,115,
-117,112,112,111,114,116,101,100,99,111,109,112,117,116,101,114,115,32,102,117,
-110,99,116,105,111,110,112,114,97,99,116,105,99,97,108,115,97,105,100,32,116,104
-,97,116,105,116,32,109,97,121,32,98,101,69,110,103,108,105,115,104,60,47,102,114
-,111,109,32,116,104,101,32,115,99,104,101,100,117,108,101,100,100,111,119,110,
-108,111,97,100,115,60,47,108,97,98,101,108,62,10,115,117,115,112,101,99,116,101,
-100,109,97,114,103,105,110,58,32,48,115,112,105,114,105,116,117,97,108,60,47,104
-,101,97,100,62,10,10,109,105,99,114,111,115,111,102,116,103,114,97,100,117,97,
-108,108,121,100,105,115,99,117,115,115,101,100,104,101,32,98,101,99,97,109,101,
-101,120,101,99,117,116,105,118,101,106,113,117,101,114,121,46,106,115,104,111,
-117,115,101,104,111,108,100,99,111,110,102,105,114,109,101,100,112,117,114,99,
-104,97,115,101,100,108,105,116,101,114,97,108,108,121,100,101,115,116,114,111,
-121,101,100,117,112,32,116,111,32,116,104,101,118,97,114,105,97,116,105,111,110,
-114,101,109,97,105,110,105,110,103,105,116,32,105,115,32,110,111,116,99,101,110,
-116,117,114,105,101,115,74,97,112,97,110,101,115,101,32,97,109,111,110,103,32,
-116,104,101,99,111,109,112,108,101,116,101,100,97,108,103,111,114,105,116,104,
-109,105,110,116,101,114,101,115,116,115,114,101,98,101,108,108,105,111,110,117,
-110,100,101,102,105,110,101,100,101,110,99,111,117,114,97,103,101,114,101,115,
-105,122,97,98,108,101,105,110,118,111,108,118,105,110,103,115,101,110,115,105,
-116,105,118,101,117,110,105,118,101,114,115,97,108,112,114,111,118,105,115,105,
-111,110,40,97,108,116,104,111,117,103,104,102,101,97,116,117,114,105,110,103,99,
-111,110,100,117,99,116,101,100,41,44,32,119,104,105,99,104,32,99,111,110,116,105
-,110,117,101,100,45,104,101,97,100,101,114,34,62,70,101,98,114,117,97,114,121,32
-,110,117,109,101,114,111,117,115,32,111,118,101,114,102,108,111,119,58,99,111,
-109,112,111,110,101,110,116,102,114,97,103,109,101,110,116,115,101,120,99,101,
-108,108,101,110,116,99,111,108,115,112,97,110,61,34,116,101,99,104,110,105,99,97
-,108,110,101,97,114,32,116,104,101,32,65,100,118,97,110,99,101,100,32,115,111,
-117,114,99,101,32,111,102,101,120,112,114,101,115,115,101,100,72,111,110,103,32,
-75,111,110,103,32,70,97,99,101,98,111,111,107,109,117,108,116,105,112,108,101,32
-,109,101,99,104,97,110,105,115,109,101,108,101,118,97,116,105,111,110,111,102,
-102,101,110,115,105,118,101,60,47,102,111,114,109,62,10,9,115,112,111,110,115,
-111,114,101,100,100,111,99,117,109,101,110,116,46,111,114,32,38,113,117,111,116,
-59,116,104,101,114,101,32,97,114,101,116,104,111,115,101,32,119,104,111,109,111,
-118,101,109,101,110,116,115,112,114,111,99,101,115,115,101,115,100,105,102,102,
-105,99,117,108,116,115,117,98,109,105,116,116,101,100,114,101,99,111,109,109,101
-,110,100,99,111,110,118,105,110,99,101,100,112,114,111,109,111,116,105,110,103,
-34,32,119,105,100,116,104,61,34,46,114,101,112,108,97,99,101,40,99,108,97,115,
-115,105,99,97,108,99,111,97,108,105,116,105,111,110,104,105,115,32,102,105,114,
-115,116,100,101,99,105,115,105,111,110,115,97,115,115,105,115,116,97,110,116,105
-,110,100,105,99,97,116,101,100,101,118,111,108,117,116,105,111,110,45,119,114,97
-,112,112,101,114,34,101,110,111,117,103,104,32,116,111,97,108,111,110,103,32,116
-,104,101,100,101,108,105,118,101,114,101,100,45,45,62,13,10,60,33,45,45,65,109,
-101,114,105,99,97,110,32,112,114,111,116,101,99,116,101,100,78,111,118,101,109,
-98,101,114,32,60,47,115,116,121,108,101,62,60,102,117,114,110,105,116,117,114,
-101,73,110,116,101,114,110,101,116,32,32,111,110,98,108,117,114,61,34,115,117,
-115,112,101,110,100,101,100,114,101,99,105,112,105,101,110,116,98,97,115,101,100
-,32,111,110,32,77,111,114,101,111,118,101,114,44,97,98,111,108,105,115,104,101,
-100,99,111,108,108,101,99,116,101,100,119,101,114,101,32,109,97,100,101,101,109,
-111,116,105,111,110,97,108,101,109,101,114,103,101,110,99,121,110,97,114,114,97,
-116,105,118,101,97,100,118,111,99,97,116,101,115,112,120,59,98,111,114,100,101,
-114,99,111,109,109,105,116,116,101,100,100,105,114,61,34,108,116,114,34,101,109,
-112,108,111,121,101,101,115,114,101,115,101,97,114,99,104,46,32,115,101,108,101,
-99,116,101,100,115,117,99,99,101,115,115,111,114,99,117,115,116,111,109,101,114,
-115,100,105,115,112,108,97,121,101,100,83,101,112,116,101,109,98,101,114,97,100,
-100,67,108,97,115,115,40,70,97,99,101,98,111,111,107,32,115,117,103,103,101,115,
-116,101,100,97,110,100,32,108,97,116,101,114,111,112,101,114,97,116,105,110,103,
-101,108,97,98,111,114,97,116,101,83,111,109,101,116,105,109,101,115,73,110,115,
-116,105,116,117,116,101,99,101,114,116,97,105,110,108,121,105,110,115,116,97,108
-,108,101,100,102,111,108,108,111,119,101,114,115,74,101,114,117,115,97,108,101,
-109,116,104,101,121,32,104,97,118,101,99,111,109,112,117,116,105,110,103,103,101
-,110,101,114,97,116,101,100,112,114,111,118,105,110,99,101,115,103,117,97,114,97
-,110,116,101,101,97,114,98,105,116,114,97,114,121,114,101,99,111,103,110,105,122
-,101,119,97,110,116,101,100,32,116,111,112,120,59,119,105,100,116,104,58,116,104
-,101,111,114,121,32,111,102,98,101,104,97,118,105,111,117,114,87,104,105,108,101
-,32,116,104,101,101,115,116,105,109,97,116,101,100,98,101,103,97,110,32,116,111,
-32,105,116,32,98,101,99,97,109,101,109,97,103,110,105,116,117,100,101,109,117,
-115,116,32,104,97,118,101,109,111,114,101,32,116,104,97,110,68,105,114,101,99,
-116,111,114,121,101,120,116,101,110,115,105,111,110,115,101,99,114,101,116,97,
-114,121,110,97,116,117,114,97,108,108,121,111,99,99,117,114,114,105,110,103,118,
-97,114,105,97,98,108,101,115,103,105,118,101,110,32,116,104,101,112,108,97,116,
-102,111,114,109,46,60,47,108,97,98,101,108,62,60,102,97,105,108,101,100,32,116,
-111,99,111,109,112,111,117,110,100,115,107,105,110,100,115,32,111,102,32,115,111
-,99,105,101,116,105,101,115,97,108,111,110,103,115,105,100,101,32,45,45,38,103,
-116,59,10,10,115,111,117,116,104,119,101,115,116,116,104,101,32,114,105,103,104,
-116,114,97,100,105,97,116,105,111,110,109,97,121,32,104,97,118,101,32,117,110,
-101,115,99,97,112,101,40,115,112,111,107,101,110,32,105,110,34,32,104,114,101,
-102,61,34,47,112,114,111,103,114,97,109,109,101,111,110,108,121,32,116,104,101,
-32,99,111,109,101,32,102,114,111,109,100,105,114,101,99,116,111,114,121,98,117,
-114,105,101,100,32,105,110,97,32,115,105,109,105,108,97,114,116,104,101,121,32,
-119,101,114,101,60,47,102,111,110,116,62,60,47,78,111,114,119,101,103,105,97,110
-,115,112,101,99,105,102,105,101,100,112,114,111,100,117,99,105,110,103,112,97,
-115,115,101,110,103,101,114,40,110,101,119,32,68,97,116,101,116,101,109,112,111,
-114,97,114,121,102,105,99,116,105,111,110,97,108,65,102,116,101,114,32,116,104,
-101,101,113,117,97,116,105,111,110,115,100,111,119,110,108,111,97,100,46,114,101
-,103,117,108,97,114,108,121,100,101,118,101,108,111,112,101,114,97,98,111,118,
-101,32,116,104,101,108,105,110,107,101,100,32,116,111,112,104,101,110,111,109,
-101,110,97,112,101,114,105,111,100,32,111,102,116,111,111,108,116,105,112,34,62,
-115,117,98,115,116,97,110,99,101,97,117,116,111,109,97,116,105,99,97,115,112,101
-,99,116,32,111,102,65,109,111,110,103,32,116,104,101,99,111,110,110,101,99,116,
-101,100,101,115,116,105,109,97,116,101,115,65,105,114,32,70,111,114,99,101,115,
-121,115,116,101,109,32,111,102,111,98,106,101,99,116,105,118,101,105,109,109,101
-,100,105,97,116,101,109,97,107,105,110,103,32,105,116,112,97,105,110,116,105,110
-,103,115,99,111,110,113,117,101,114,101,100,97,114,101,32,115,116,105,108,108,
-112,114,111,99,101,100,117,114,101,103,114,111,119,116,104,32,111,102,104,101,97
-,100,101,100,32,98,121,69,117,114,111,112,101,97,110,32,100,105,118,105,115,105,
-111,110,115,109,111,108,101,99,117,108,101,115,102,114,97,110,99,104,105,115,101
-,105,110,116,101,110,116,105,111,110,97,116,116,114,97,99,116,101,100,99,104,105
-,108,100,104,111,111,100,97,108,115,111,32,117,115,101,100,100,101,100,105,99,97
-,116,101,100,115,105,110,103,97,112,111,114,101,100,101,103,114,101,101,32,111,
-102,102,97,116,104,101,114,32,111,102,99,111,110,102,108,105,99,116,115,60,47,97
-,62,60,47,112,62,10,99,97,109,101,32,102,114,111,109,119,101,114,101,32,117,115,
-101,100,110,111,116,101,32,116,104,97,116,114,101,99,101,105,118,105,110,103,69,
-120,101,99,117,116,105,118,101,101,118,101,110,32,109,111,114,101,97,99,99,101,
-115,115,32,116,111,99,111,109,109,97,110,100,101,114,80,111,108,105,116,105,99,
-97,108,109,117,115,105,99,105,97,110,115,100,101,108,105,99,105,111,117,115,112,
-114,105,115,111,110,101,114,115,97,100,118,101,110,116,32,111,102,85,84,70,45,56
-,34,32,47,62,60,33,91,67,68,65,84,65,91,34,62,67,111,110,116,97,99,116,83,111,
-117,116,104,101,114,110,32,98,103,99,111,108,111,114,61,34,115,101,114,105,101,
-115,32,111,102,46,32,73,116,32,119,97,115,32,105,110,32,69,117,114,111,112,101,
-112,101,114,109,105,116,116,101,100,118,97,108,105,100,97,116,101,46,97,112,112,
-101,97,114,105,110,103,111,102,102,105,99,105,97,108,115,115,101,114,105,111,117
-,115,108,121,45,108,97,110,103,117,97,103,101,105,110,105,116,105,97,116,101,100
-,101,120,116,101,110,100,105,110,103,108,111,110,103,45,116,101,114,109,105,110,
-102,108,97,116,105,111,110,115,117,99,104,32,116,104,97,116,103,101,116,67,111,
-111,107,105,101,109,97,114,107,101,100,32,98,121,60,47,98,117,116,116,111,110,62
-,105,109,112,108,101,109,101,110,116,98,117,116,32,105,116,32,105,115,105,110,99
-,114,101,97,115,101,115,100,111,119,110,32,116,104,101,32,114,101,113,117,105,
-114,105,110,103,100,101,112,101,110,100,101,110,116,45,45,62,10,60,33,45,45,32,
-105,110,116,101,114,118,105,101,119,87,105,116,104,32,116,104,101,32,99,111,112,
-105,101,115,32,111,102,99,111,110,115,101,110,115,117,115,119,97,115,32,98,117,
-105,108,116,86,101,110,101,122,117,101,108,97,40,102,111,114,109,101,114,108,121
-,116,104,101,32,115,116,97,116,101,112,101,114,115,111,110,110,101,108,115,116,
-114,97,116,101,103,105,99,102,97,118,111,117,114,32,111,102,105,110,118,101,110,
-116,105,111,110,87,105,107,105,112,101,100,105,97,99,111,110,116,105,110,101,110
-,116,118,105,114,116,117,97,108,108,121,119,104,105,99,104,32,119,97,115,112,114
-,105,110,99,105,112,108,101,67,111,109,112,108,101,116,101,32,105,100,101,110,
-116,105,99,97,108,115,104,111,119,32,116,104,97,116,112,114,105,109,105,116,105,
-118,101,97,119,97,121,32,102,114,111,109,109,111,108,101,99,117,108,97,114,112,
-114,101,99,105,115,101,108,121,100,105,115,115,111,108,118,101,100,85,110,100,
-101,114,32,116,104,101,118,101,114,115,105,111,110,61,34,62,38,110,98,115,112,59
-,60,47,73,116,32,105,115,32,116,104,101,32,84,104,105,115,32,105,115,32,119,105,
-108,108,32,104,97,118,101,111,114,103,97,110,105,115,109,115,115,111,109,101,32,
-116,105,109,101,70,114,105,101,100,114,105,99,104,119,97,115,32,102,105,114,115,
-116,116,104,101,32,111,110,108,121,32,102,97,99,116,32,116,104,97,116,102,111,
-114,109,32,105,100,61,34,112,114,101,99,101,100,105,110,103,84,101,99,104,110,
-105,99,97,108,112,104,121,115,105,99,105,115,116,111,99,99,117,114,115,32,105,
-110,110,97,118,105,103,97,116,111,114,115,101,99,116,105,111,110,34,62,115,112,
-97,110,32,105,100,61,34,115,111,117,103,104,116,32,116,111,98,101,108,111,119,32
-,116,104,101,115,117,114,118,105,118,105,110,103,125,60,47,115,116,121,108,101,
-62,104,105,115,32,100,101,97,116,104,97,115,32,105,110,32,116,104,101,99,97,117,
-115,101,100,32,98,121,112,97,114,116,105,97,108,108,121,101,120,105,115,116,105,
-110,103,32,117,115,105,110,103,32,116,104,101,119,97,115,32,103,105,118,101,110,
-97,32,108,105,115,116,32,111,102,108,101,118,101,108,115,32,111,102,110,111,116,
-105,111,110,32,111,102,79,102,102,105,99,105,97,108,32,100,105,115,109,105,115,
-115,101,100,115,99,105,101,110,116,105,115,116,114,101,115,101,109,98,108,101,
-115,100,117,112,108,105,99,97,116,101,101,120,112,108,111,115,105,118,101,114,
-101,99,111,118,101,114,101,100,97,108,108,32,111,116,104,101,114,103,97,108,108,
-101,114,105,101,115,123,112,97,100,100,105,110,103,58,112,101,111,112,108,101,32
-,111,102,114,101,103,105,111,110,32,111,102,97,100,100,114,101,115,115,101,115,
-97,115,115,111,99,105,97,116,101,105,109,103,32,97,108,116,61,34,105,110,32,109,
-111,100,101,114,110,115,104,111,117,108,100,32,98,101,109,101,116,104,111,100,32
-,111,102,114,101,112,111,114,116,105,110,103,116,105,109,101,115,116,97,109,112,
-110,101,101,100,101,100,32,116,111,116,104,101,32,71,114,101,97,116,114,101,103,
-97,114,100,105,110,103,115,101,101,109,101,100,32,116,111,118,105,101,119,101,
-100,32,97,115,105,109,112,97,99,116,32,111,110,105,100,101,97,32,116,104,97,116,
-116,104,101,32,87,111,114,108,100,104,101,105,103,104,116,32,111,102,101,120,112
-,97,110,100,105,110,103,84,104,101,115,101,32,97,114,101,99,117,114,114,101,110,
-116,34,62,99,97,114,101,102,117,108,108,121,109,97,105,110,116,97,105,110,115,99
-,104,97,114,103,101,32,111,102,67,108,97,115,115,105,99,97,108,97,100,100,114,
-101,115,115,101,100,112,114,101,100,105,99,116,101,100,111,119,110,101,114,115,
-104,105,112,60,100,105,118,32,105,100,61,34,114,105,103,104,116,34,62,13,10,114,
-101,115,105,100,101,110,99,101,108,101,97,118,101,32,116,104,101,99,111,110,116,
-101,110,116,34,62,97,114,101,32,111,102,116,101,110,32,32,125,41,40,41,59,13,10,
-112,114,111,98,97,98,108,121,32,80,114,111,102,101,115,115,111,114,45,98,117,116
-,116,111,110,34,32,114,101,115,112,111,110,100,101,100,115,97,121,115,32,116,104
-,97,116,104,97,100,32,116,111,32,98,101,112,108,97,99,101,100,32,105,110,72,117,
-110,103,97,114,105,97,110,115,116,97,116,117,115,32,111,102,115,101,114,118,101,
-115,32,97,115,85,110,105,118,101,114,115,97,108,101,120,101,99,117,116,105,111,
-110,97,103,103,114,101,103,97,116,101,102,111,114,32,119,104,105,99,104,105,110,
-102,101,99,116,105,111,110,97,103,114,101,101,100,32,116,111,104,111,119,101,118
-,101,114,44,32,112,111,112,117,108,97,114,34,62,112,108,97,99,101,100,32,111,110
-,99,111,110,115,116,114,117,99,116,101,108,101,99,116,111,114,97,108,115,121,109
-,98,111,108,32,111,102,105,110,99,108,117,100,105,110,103,114,101,116,117,114,
-110,32,116,111,97,114,99,104,105,116,101,99,116,67,104,114,105,115,116,105,97,
-110,112,114,101,118,105,111,117,115,32,108,105,118,105,110,103,32,105,110,101,97
-,115,105,101,114,32,116,111,112,114,111,102,101,115,115,111,114,10,38,108,116,59
-,33,45,45,32,101,102,102,101,99,116,32,111,102,97,110,97,108,121,116,105,99,115,
-119,97,115,32,116,97,107,101,110,119,104,101,114,101,32,116,104,101,116,111,111,
-107,32,111,118,101,114,98,101,108,105,101,102,32,105,110,65,102,114,105,107,97,
-97,110,115,97,115,32,102,97,114,32,97,115,112,114,101,118,101,110,116,101,100,
-119,111,114,107,32,119,105,116,104,97,32,115,112,101,99,105,97,108,60,102,105,
-101,108,100,115,101,116,67,104,114,105,115,116,109,97,115,82,101,116,114,105,101
-,118,101,100,10,10,73,110,32,116,104,101,32,98,97,99,107,32,105,110,116,111,110,
-111,114,116,104,101,97,115,116,109,97,103,97,122,105,110,101,115,62,60,115,116,
-114,111,110,103,62,99,111,109,109,105,116,116,101,101,103,111,118,101,114,110,
-105,110,103,103,114,111,117,112,115,32,111,102,115,116,111,114,101,100,32,105,
-110,101,115,116,97,98,108,105,115,104,97,32,103,101,110,101,114,97,108,105,116,
-115,32,102,105,114,115,116,116,104,101,105,114,32,111,119,110,112,111,112,117,
-108,97,116,101,100,97,110,32,111,98,106,101,99,116,67,97,114,105,98,98,101,97,
-110,97,108,108,111,119,32,116,104,101,100,105,115,116,114,105,99,116,115,119,105
-,115,99,111,110,115,105,110,108,111,99,97,116,105,111,110,46,59,32,119,105,100,
-116,104,58,32,105,110,104,97,98,105,116,101,100,83,111,99,105,97,108,105,115,116
-,74,97,110,117,97,114,121,32,49,60,47,102,111,111,116,101,114,62,115,105,109,105
-,108,97,114,108,121,99,104,111,105,99,101,32,111,102,116,104,101,32,115,97,109,
-101,32,115,112,101,99,105,102,105,99,32,98,117,115,105,110,101,115,115,32,84,104
-,101,32,102,105,114,115,116,46,108,101,110,103,116,104,59,32,100,101,115,105,114
-,101,32,116,111,100,101,97,108,32,119,105,116,104,115,105,110,99,101,32,116,104,
-101,117,115,101,114,65,103,101,110,116,99,111,110,99,101,105,118,101,100,105,110
-,100,101,120,46,112,104,112,97,115,32,38,113,117,111,116,59,101,110,103,97,103,
-101,32,105,110,114,101,99,101,110,116,108,121,44,102,101,119,32,121,101,97,114,
-115,119,101,114,101,32,97,108,115,111,10,60,104,101,97,100,62,10,60,101,100,105,
-116,101,100,32,98,121,97,114,101,32,107,110,111,119,110,99,105,116,105,101,115,
-32,105,110,97,99,99,101,115,115,107,101,121,99,111,110,100,101,109,110,101,100,
-97,108,115,111,32,104,97,118,101,115,101,114,118,105,99,101,115,44,102,97,109,
-105,108,121,32,111,102,83,99,104,111,111,108,32,111,102,99,111,110,118,101,114,
-116,101,100,110,97,116,117,114,101,32,111,102,32,108,97,110,103,117,97,103,101,
-109,105,110,105,115,116,101,114,115,60,47,111,98,106,101,99,116,62,116,104,101,
-114,101,32,105,115,32,97,32,112,111,112,117,108,97,114,115,101,113,117,101,110,
-99,101,115,97,100,118,111,99,97,116,101,100,84,104,101,121,32,119,101,114,101,97
-,110,121,32,111,116,104,101,114,108,111,99,97,116,105,111,110,61,101,110,116,101
-,114,32,116,104,101,109,117,99,104,32,109,111,114,101,114,101,102,108,101,99,116
-,101,100,119,97,115,32,110,97,109,101,100,111,114,105,103,105,110,97,108,32,97,
-32,116,121,112,105,99,97,108,119,104,101,110,32,116,104,101,121,101,110,103,105,
-110,101,101,114,115,99,111,117,108,100,32,110,111,116,114,101,115,105,100,101,
-110,116,115,119,101,100,110,101,115,100,97,121,116,104,101,32,116,104,105,114,
-100,32,112,114,111,100,117,99,116,115,74,97,110,117,97,114,121,32,50,119,104,97,
-116,32,116,104,101,121,97,32,99,101,114,116,97,105,110,114,101,97,99,116,105,111
-,110,115,112,114,111,99,101,115,115,111,114,97,102,116,101,114,32,104,105,115,
-116,104,101,32,108,97,115,116,32,99,111,110,116,97,105,110,101,100,34,62,60,47,
-100,105,118,62,10,60,47,97,62,60,47,116,100,62,100,101,112,101,110,100,32,111,
-110,115,101,97,114,99,104,34,62,10,112,105,101,99,101,115,32,111,102,99,111,109,
-112,101,116,105,110,103,82,101,102,101,114,101,110,99,101,116,101,110,110,101,
-115,115,101,101,119,104,105,99,104,32,104,97,115,32,118,101,114,115,105,111,110,
-61,60,47,115,112,97,110,62,32,60,60,47,104,101,97,100,101,114,62,103,105,118,101
-,115,32,116,104,101,104,105,115,116,111,114,105,97,110,118,97,108,117,101,61,34,
-34,62,112,97,100,100,105,110,103,58,48,118,105,101,119,32,116,104,97,116,116,111
-,103,101,116,104,101,114,44,116,104,101,32,109,111,115,116,32,119,97,115,32,102,
-111,117,110,100,115,117,98,115,101,116,32,111,102,97,116,116,97,99,107,32,111,
-110,99,104,105,108,100,114,101,110,44,112,111,105,110,116,115,32,111,102,112,101
-,114,115,111,110,97,108,32,112,111,115,105,116,105,111,110,58,97,108,108,101,103
-,101,100,108,121,67,108,101,118,101,108,97,110,100,119,97,115,32,108,97,116,101,
-114,97,110,100,32,97,102,116,101,114,97,114,101,32,103,105,118,101,110,119,97,
-115,32,115,116,105,108,108,115,99,114,111,108,108,105,110,103,100,101,115,105,
-103,110,32,111,102,109,97,107,101,115,32,116,104,101,109,117,99,104,32,108,101,
-115,115,65,109,101,114,105,99,97,110,115,46,10,10,65,102,116,101,114,32,44,32,98
-,117,116,32,116,104,101,77,117,115,101,117,109,32,111,102,108,111,117,105,115,
-105,97,110,97,40,102,114,111,109,32,116,104,101,109,105,110,110,101,115,111,116,
-97,112,97,114,116,105,99,108,101,115,97,32,112,114,111,99,101,115,115,68,111,109
-,105,110,105,99,97,110,118,111,108,117,109,101,32,111,102,114,101,116,117,114,
-110,105,110,103,100,101,102,101,110,115,105,118,101,48,48,112,120,124,114,105,
-103,104,109,97,100,101,32,102,114,111,109,109,111,117,115,101,111,118,101,114,34
-,32,115,116,121,108,101,61,34,115,116,97,116,101,115,32,111,102,40,119,104,105,
-99,104,32,105,115,99,111,110,116,105,110,117,101,115,70,114,97,110,99,105,115,99
-,111,98,117,105,108,100,105,110,103,32,119,105,116,104,111,117,116,32,97,119,105
-,116,104,32,115,111,109,101,119,104,111,32,119,111,117,108,100,97,32,102,111,114
-,109,32,111,102,97,32,112,97,114,116,32,111,102,98,101,102,111,114,101,32,105,
-116,107,110,111,119,110,32,97,115,32,32,83,101,114,118,105,99,101,115,108,111,99
-,97,116,105,111,110,32,97,110,100,32,111,102,116,101,110,109,101,97,115,117,114,
-105,110,103,97,110,100,32,105,116,32,105,115,112,97,112,101,114,98,97,99,107,118
-,97,108,117,101,115,32,111,102,13,10,60,116,105,116,108,101,62,61,32,119,105,110
-,100,111,119,46,100,101,116,101,114,109,105,110,101,101,114,38,113,117,111,116,
-59,32,112,108,97,121,101,100,32,98,121,97,110,100,32,101,97,114,108,121,60,47,99
-,101,110,116,101,114,62,102,114,111,109,32,116,104,105,115,116,104,101,32,116,
-104,114,101,101,112,111,119,101,114,32,97,110,100,111,102,32,38,113,117,111,116,
-59,105,110,110,101,114,72,84,77,76,60,97,32,104,114,101,102,61,34,121,58,105,110
-,108,105,110,101,59,67,104,117,114,99,104,32,111,102,116,104,101,32,101,118,101,
-110,116,118,101,114,121,32,104,105,103,104,111,102,102,105,99,105,97,108,32,45,
-104,101,105,103,104,116,58,32,99,111,110,116,101,110,116,61,34,47,99,103,105,45,
-98,105,110,47,116,111,32,99,114,101,97,116,101,97,102,114,105,107,97,97,110,115,
-101,115,112,101,114,97,110,116,111,102,114,97,110,195,167,97,105,115,108,97,116,
-118,105,101,197,161,117,108,105,101,116,117,118,105,197,179,196,140,101,197,161,
-116,105,110,97,196,141,101,197,161,116,105,110,97,224,185,132,224,184,151,224,
-184,162,230,151,165,230,156,172,232,170,158,231,174,128,228,189,147,229,173,151,
-231,185,129,233,171,148,229,173,151,237,149,156,234,181,173,236,150,180,228,184,
-186,228,187,128,228,185,136,232,174,161,231,174,151,230,156,186,231,172,148,232,
-174,176,230,156,172,232,168,142,232,171,150,229,141,128,230,156,141,229,138,161,
-229,153,168,228,186,146,232,129,148,231,189,145,230,136,191,229,156,176,228,186,
-167,228,191,177,228,185,144,233,131,168,229,135,186,231,137,136,231,164,190,230,
-142,146,232,161,140,230,166,156,233,131,168,232,144,189,230,160,188,232,191,155,
-228,184,128,230,173,165,230,148,175,228,187,152,229,174,157,233,170,140,232,175,
-129,231,160,129,229,167,148,229,145,152,228,188,154,230,149,176,230,141,174,229,
-186,147,230,182,136,232,180,185,232,128,133,229,138,158,229,133,172,229,174,164,
-232,174,168,232,174,186,229,140,186,230,183,177,229,156,179,229,184,130,230,146,
-173,230,148,190,229,153,168,229,140,151,228,186,172,229,184,130,229,164,167,229,
-173,166,231,148,159,232,182,138,230,157,165,232,182,138,231,174,161,231,144,134,
-229,145,152,228,191,161,230,129,175,231,189,145,115,101,114,118,105,99,105,111,
-115,97,114,116,195,173,99,117,108,111,97,114,103,101,110,116,105,110,97,98,97,
-114,99,101,108,111,110,97,99,117,97,108,113,117,105,101,114,112,117,98,108,105,
-99,97,100,111,112,114,111,100,117,99,116,111,115,112,111,108,195,173,116,105,99,
-97,114,101,115,112,117,101,115,116,97,119,105,107,105,112,101,100,105,97,115,105
-,103,117,105,101,110,116,101,98,195,186,115,113,117,101,100,97,99,111,109,117,
-110,105,100,97,100,115,101,103,117,114,105,100,97,100,112,114,105,110,99,105,112
-,97,108,112,114,101,103,117,110,116,97,115,99,111,110,116,101,110,105,100,111,
-114,101,115,112,111,110,100,101,114,118,101,110,101,122,117,101,108,97,112,114,
-111,98,108,101,109,97,115,100,105,99,105,101,109,98,114,101,114,101,108,97,99,
-105,195,179,110,110,111,118,105,101,109,98,114,101,115,105,109,105,108,97,114,
-101,115,112,114,111,121,101,99,116,111,115,112,114,111,103,114,97,109,97,115,105
-,110,115,116,105,116,117,116,111,97,99,116,105,118,105,100,97,100,101,110,99,117
-,101,110,116,114,97,101,99,111,110,111,109,195,173,97,105,109,195,161,103,101,
-110,101,115,99,111,110,116,97,99,116,97,114,100,101,115,99,97,114,103,97,114,110
-,101,99,101,115,97,114,105,111,97,116,101,110,99,105,195,179,110,116,101,108,195
-,169,102,111,110,111,99,111,109,105,115,105,195,179,110,99,97,110,99,105,111,110
-,101,115,99,97,112,97,99,105,100,97,100,101,110,99,111,110,116,114,97,114,97,110
-,195,161,108,105,115,105,115,102,97,118,111,114,105,116,111,115,116,195,169,114,
-109,105,110,111,115,112,114,111,118,105,110,99,105,97,101,116,105,113,117,101,
-116,97,115,101,108,101,109,101,110,116,111,115,102,117,110,99,105,111,110,101,
-115,114,101,115,117,108,116,97,100,111,99,97,114,195,161,99,116,101,114,112,114,
-111,112,105,101,100,97,100,112,114,105,110,99,105,112,105,111,110,101,99,101,115
-,105,100,97,100,109,117,110,105,99,105,112,97,108,99,114,101,97,99,105,195,179,
-110,100,101,115,99,97,114,103,97,115,112,114,101,115,101,110,99,105,97,99,111,
-109,101,114,99,105,97,108,111,112,105,110,105,111,110,101,115,101,106,101,114,99
-,105,99,105,111,101,100,105,116,111,114,105,97,108,115,97,108,97,109,97,110,99,
-97,103,111,110,122,195,161,108,101,122,100,111,99,117,109,101,110,116,111,112,
-101,108,195,173,99,117,108,97,114,101,99,105,101,110,116,101,115,103,101,110,101
-,114,97,108,101,115,116,97,114,114,97,103,111,110,97,112,114,195,161,99,116,105,
-99,97,110,111,118,101,100,97,100,101,115,112,114,111,112,117,101,115,116,97,112,
-97,99,105,101,110,116,101,115,116,195,169,99,110,105,99,97,115,111,98,106,101,
-116,105,118,111,115,99,111,110,116,97,99,116,111,115,224,164,174,224,165,135,224
-,164,130,224,164,178,224,164,191,224,164,143,224,164,185,224,165,136,224,164,130
-,224,164,151,224,164,175,224,164,190,224,164,184,224,164,190,224,164,165,224,164
-,143,224,164,181,224,164,130,224,164,176,224,164,185,224,165,135,224,164,149,224
-,165,139,224,164,136,224,164,149,224,165,129,224,164,155,224,164,176,224,164,185
-,224,164,190,224,164,172,224,164,190,224,164,166,224,164,149,224,164,185,224,164
-,190,224,164,184,224,164,173,224,165,128,224,164,185,224,165,129,224,164,143,224
-,164,176,224,164,185,224,165,128,224,164,174,224,165,136,224,164,130,224,164,166
-,224,164,191,224,164,168,224,164,172,224,164,190,224,164,164,100,105,112,108,111
-,100,111,99,115,224,164,184,224,164,174,224,164,175,224,164,176,224,165,130,224,
-164,170,224,164,168,224,164,190,224,164,174,224,164,170,224,164,164,224,164,190,
-224,164,171,224,164,191,224,164,176,224,164,148,224,164,184,224,164,164,224,164,
-164,224,164,176,224,164,185,224,164,178,224,165,139,224,164,151,224,164,185,224,
-165,129,224,164,134,224,164,172,224,164,190,224,164,176,224,164,166,224,165,135,
-224,164,182,224,164,185,224,165,129,224,164,136,224,164,150,224,165,135,224,164,
-178,224,164,175,224,164,166,224,164,191,224,164,149,224,164,190,224,164,174,224,
-164,181,224,165,135,224,164,172,224,164,164,224,165,128,224,164,168,224,164,172,
-224,165,128,224,164,154,224,164,174,224,165,140,224,164,164,224,164,184,224,164,
-190,224,164,178,224,164,178,224,165,135,224,164,150,224,164,156,224,165,137,224,
-164,172,224,164,174,224,164,166,224,164,166,224,164,164,224,164,165,224,164,190,
-224,164,168,224,164,185,224,165,128,224,164,182,224,164,185,224,164,176,224,164,
-133,224,164,178,224,164,151,224,164,149,224,164,173,224,165,128,224,164,168,224,
-164,151,224,164,176,224,164,170,224,164,190,224,164,184,224,164,176,224,164,190,
-224,164,164,224,164,149,224,164,191,224,164,143,224,164,137,224,164,184,224,165,
-135,224,164,151,224,164,175,224,165,128,224,164,185,224,165,130,224,164,129,224,
-164,134,224,164,151,224,165,135,224,164,159,224,165,128,224,164,174,224,164,150,
-224,165,139,224,164,156,224,164,149,224,164,190,224,164,176,224,164,133,224,164,
-173,224,165,128,224,164,151,224,164,175,224,165,135,224,164,164,224,165,129,224,
-164,174,224,164,181,224,165,139,224,164,159,224,164,166,224,165,135,224,164,130,
-224,164,133,224,164,151,224,164,176,224,164,144,224,164,184,224,165,135,224,164,
-174,224,165,135,224,164,178,224,164,178,224,164,151,224,164,190,224,164,185,224,
-164,190,224,164,178,224,164,138,224,164,170,224,164,176,224,164,154,224,164,190,
-224,164,176,224,164,144,224,164,184,224,164,190,224,164,166,224,165,135,224,164,
-176,224,164,156,224,164,191,224,164,184,224,164,166,224,164,191,224,164,178,224,
-164,172,224,164,130,224,164,166,224,164,172,224,164,168,224,164,190,224,164,185,
-224,165,130,224,164,130,224,164,178,224,164,190,224,164,150,224,164,156,224,165,
-128,224,164,164,224,164,172,224,164,159,224,164,168,224,164,174,224,164,191,224,
-164,178,224,164,135,224,164,184,224,165,135,224,164,134,224,164,168,224,165,135,
-224,164,168,224,164,175,224,164,190,224,164,149,224,165,129,224,164,178,224,164,
-178,224,165,137,224,164,151,224,164,173,224,164,190,224,164,151,224,164,176,224,
-165,135,224,164,178,224,164,156,224,164,151,224,164,185,224,164,176,224,164,190,
-224,164,174,224,164,178,224,164,151,224,165,135,224,164,170,224,165,135,224,164,
-156,224,164,185,224,164,190,224,164,165,224,164,135,224,164,184,224,165,128,224,
-164,184,224,164,185,224,165,128,224,164,149,224,164,178,224,164,190,224,164,160,
-224,165,128,224,164,149,224,164,185,224,164,190,224,164,129,224,164,166,224,165,
-130,224,164,176,224,164,164,224,164,185,224,164,164,224,164,184,224,164,190,224,
-164,164,224,164,175,224,164,190,224,164,166,224,164,134,224,164,175,224,164,190,
-224,164,170,224,164,190,224,164,149,224,164,149,224,165,140,224,164,168,224,164,
-182,224,164,190,224,164,174,224,164,166,224,165,135,224,164,150,224,164,175,224,
-164,185,224,165,128,224,164,176,224,164,190,224,164,175,224,164,150,224,165,129,
-224,164,166,224,164,178,224,164,151,224,165,128,99,97,116,101,103,111,114,105,
-101,115,101,120,112,101,114,105,101,110,99,101,60,47,116,105,116,108,101,62,13,
-10,67,111,112,121,114,105,103,104,116,32,106,97,118,97,115,99,114,105,112,116,99
-,111,110,100,105,116,105,111,110,115,101,118,101,114,121,116,104,105,110,103,60,
-112,32,99,108,97,115,115,61,34,116,101,99,104,110,111,108,111,103,121,98,97,99,
-107,103,114,111,117,110,100,60,97,32,99,108,97,115,115,61,34,109,97,110,97,103,
-101,109,101,110,116,38,99,111,112,121,59,32,50,48,49,106,97,118,97,83,99,114,105
-,112,116,99,104,97,114,97,99,116,101,114,115,98,114,101,97,100,99,114,117,109,98
-,116,104,101,109,115,101,108,118,101,115,104,111,114,105,122,111,110,116,97,108,
-103,111,118,101,114,110,109,101,110,116,67,97,108,105,102,111,114,110,105,97,97,
-99,116,105,118,105,116,105,101,115,100,105,115,99,111,118,101,114,101,100,78,97,
-118,105,103,97,116,105,111,110,116,114,97,110,115,105,116,105,111,110,99,111,110
-,110,101,99,116,105,111,110,110,97,118,105,103,97,116,105,111,110,97,112,112,101
-,97,114,97,110,99,101,60,47,116,105,116,108,101,62,60,109,99,104,101,99,107,98,
-111,120,34,32,116,101,99,104,110,105,113,117,101,115,112,114,111,116,101,99,116,
-105,111,110,97,112,112,97,114,101,110,116,108,121,97,115,32,119,101,108,108,32,
-97,115,117,110,116,39,44,32,39,85,65,45,114,101,115,111,108,117,116,105,111,110,
-111,112,101,114,97,116,105,111,110,115,116,101,108,101,118,105,115,105,111,110,
-116,114,97,110,115,108,97,116,101,100,87,97,115,104,105,110,103,116,111,110,110,
-97,118,105,103,97,116,111,114,46,32,61,32,119,105,110,100,111,119,46,105,109,112
-,114,101,115,115,105,111,110,38,108,116,59,98,114,38,103,116,59,108,105,116,101,
-114,97,116,117,114,101,112,111,112,117,108,97,116,105,111,110,98,103,99,111,108,
-111,114,61,34,35,101,115,112,101,99,105,97,108,108,121,32,99,111,110,116,101,110
-,116,61,34,112,114,111,100,117,99,116,105,111,110,110,101,119,115,108,101,116,
-116,101,114,112,114,111,112,101,114,116,105,101,115,100,101,102,105,110,105,116,
-105,111,110,108,101,97,100,101,114,115,104,105,112,84,101,99,104,110,111,108,111
-,103,121,80,97,114,108,105,97,109,101,110,116,99,111,109,112,97,114,105,115,111,
-110,117,108,32,99,108,97,115,115,61,34,46,105,110,100,101,120,79,102,40,34,99,
-111,110,99,108,117,115,105,111,110,100,105,115,99,117,115,115,105,111,110,99,111
-,109,112,111,110,101,110,116,115,98,105,111,108,111,103,105,99,97,108,82,101,118
-,111,108,117,116,105,111,110,95,99,111,110,116,97,105,110,101,114,117,110,100,
-101,114,115,116,111,111,100,110,111,115,99,114,105,112,116,62,60,112,101,114,109
-,105,115,115,105,111,110,101,97,99,104,32,111,116,104,101,114,97,116,109,111,115
-,112,104,101,114,101,32,111,110,102,111,99,117,115,61,34,60,102,111,114,109,32,
-105,100,61,34,112,114,111,99,101,115,115,105,110,103,116,104,105,115,46,118,97,
-108,117,101,103,101,110,101,114,97,116,105,111,110,67,111,110,102,101,114,101,
-110,99,101,115,117,98,115,101,113,117,101,110,116,119,101,108,108,45,107,110,111
-,119,110,118,97,114,105,97,116,105,111,110,115,114,101,112,117,116,97,116,105,
-111,110,112,104,101,110,111,109,101,110,111,110,100,105,115,99,105,112,108,105,
-110,101,108,111,103,111,46,112,110,103,34,32,40,100,111,99,117,109,101,110,116,
-44,98,111,117,110,100,97,114,105,101,115,101,120,112,114,101,115,115,105,111,110
-,115,101,116,116,108,101,109,101,110,116,66,97,99,107,103,114,111,117,110,100,
-111,117,116,32,111,102,32,116,104,101,101,110,116,101,114,112,114,105,115,101,40
-,34,104,116,116,112,115,58,34,32,117,110,101,115,99,97,112,101,40,34,112,97,115,
-115,119,111,114,100,34,32,100,101,109,111,99,114,97,116,105,99,60,97,32,104,114,
-101,102,61,34,47,119,114,97,112,112,101,114,34,62,10,109,101,109,98,101,114,115,
-104,105,112,108,105,110,103,117,105,115,116,105,99,112,120,59,112,97,100,100,105
-,110,103,112,104,105,108,111,115,111,112,104,121,97,115,115,105,115,116,97,110,
-99,101,117,110,105,118,101,114,115,105,116,121,102,97,99,105,108,105,116,105,101
-,115,114,101,99,111,103,110,105,122,101,100,112,114,101,102,101,114,101,110,99,
-101,105,102,32,40,116,121,112,101,111,102,109,97,105,110,116,97,105,110,101,100,
-118,111,99,97,98,117,108,97,114,121,104,121,112,111,116,104,101,115,105,115,46,
-115,117,98,109,105,116,40,41,59,38,97,109,112,59,110,98,115,112,59,97,110,110,
-111,116,97,116,105,111,110,98,101,104,105,110,100,32,116,104,101,70,111,117,110,
-100,97,116,105,111,110,112,117,98,108,105,115,104,101,114,34,97,115,115,117,109,
-112,116,105,111,110,105,110,116,114,111,100,117,99,101,100,99,111,114,114,117,
-112,116,105,111,110,115,99,105,101,110,116,105,115,116,115,101,120,112,108,105,
-99,105,116,108,121,105,110,115,116,101,97,100,32,111,102,100,105,109,101,110,115
-,105,111,110,115,32,111,110,67,108,105,99,107,61,34,99,111,110,115,105,100,101,
-114,101,100,100,101,112,97,114,116,109,101,110,116,111,99,99,117,112,97,116,105,
-111,110,115,111,111,110,32,97,102,116,101,114,105,110,118,101,115,116,109,101,
-110,116,112,114,111,110,111,117,110,99,101,100,105,100,101,110,116,105,102,105,
-101,100,101,120,112,101,114,105,109,101,110,116,77,97,110,97,103,101,109,101,110
-,116,103,101,111,103,114,97,112,104,105,99,34,32,104,101,105,103,104,116,61,34,
-108,105,110,107,32,114,101,108,61,34,46,114,101,112,108,97,99,101,40,47,100,101,
-112,114,101,115,115,105,111,110,99,111,110,102,101,114,101,110,99,101,112,117,
-110,105,115,104,109,101,110,116,101,108,105,109,105,110,97,116,101,100,114,101,
-115,105,115,116,97,110,99,101,97,100,97,112,116,97,116,105,111,110,111,112,112,
-111,115,105,116,105,111,110,119,101,108,108,32,107,110,111,119,110,115,117,112,
-112,108,101,109,101,110,116,100,101,116,101,114,109,105,110,101,100,104,49,32,99
-,108,97,115,115,61,34,48,112,120,59,109,97,114,103,105,110,109,101,99,104,97,110
-,105,99,97,108,115,116,97,116,105,115,116,105,99,115,99,101,108,101,98,114,97,
-116,101,100,71,111,118,101,114,110,109,101,110,116,10,10,68,117,114,105,110,103,
-32,116,100,101,118,101,108,111,112,101,114,115,97,114,116,105,102,105,99,105,97,
-108,101,113,117,105,118,97,108,101,110,116,111,114,105,103,105,110,97,116,101,
-100,67,111,109,109,105,115,115,105,111,110,97,116,116,97,99,104,109,101,110,116,
-60,115,112,97,110,32,105,100,61,34,116,104,101,114,101,32,119,101,114,101,78,101
-,100,101,114,108,97,110,100,115,98,101,121,111,110,100,32,116,104,101,114,101,
-103,105,115,116,101,114,101,100,106,111,117,114,110,97,108,105,115,116,102,114,
-101,113,117,101,110,116,108,121,97,108,108,32,111,102,32,116,104,101,108,97,110,
-103,61,34,101,110,34,32,60,47,115,116,121,108,101,62,13,10,97,98,115,111,108,117
-,116,101,59,32,115,117,112,112,111,114,116,105,110,103,101,120,116,114,101,109,
-101,108,121,32,109,97,105,110,115,116,114,101,97,109,60,47,115,116,114,111,110,
-103,62,32,112,111,112,117,108,97,114,105,116,121,101,109,112,108,111,121,109,101
-,110,116,60,47,116,97,98,108,101,62,13,10,32,99,111,108,115,112,97,110,61,34,60,
-47,102,111,114,109,62,10,32,32,99,111,110,118,101,114,115,105,111,110,97,98,111,
-117,116,32,116,104,101,32,60,47,112,62,60,47,100,105,118,62,105,110,116,101,103,
-114,97,116,101,100,34,32,108,97,110,103,61,34,101,110,80,111,114,116,117,103,117
-,101,115,101,115,117,98,115,116,105,116,117,116,101,105,110,100,105,118,105,100,
-117,97,108,105,109,112,111,115,115,105,98,108,101,109,117,108,116,105,109,101,
-100,105,97,97,108,109,111,115,116,32,97,108,108,112,120,32,115,111,108,105,100,
-32,35,97,112,97,114,116,32,102,114,111,109,115,117,98,106,101,99,116,32,116,111,
-105,110,32,69,110,103,108,105,115,104,99,114,105,116,105,99,105,122,101,100,101,
-120,99,101,112,116,32,102,111,114,103,117,105,100,101,108,105,110,101,115,111,
-114,105,103,105,110,97,108,108,121,114,101,109,97,114,107,97,98,108,101,116,104,
-101,32,115,101,99,111,110,100,104,50,32,99,108,97,115,115,61,34,60,97,32,116,105
-,116,108,101,61,34,40,105,110,99,108,117,100,105,110,103,112,97,114,97,109,101,
-116,101,114,115,112,114,111,104,105,98,105,116,101,100,61,32,34,104,116,116,112,
-58,47,47,100,105,99,116,105,111,110,97,114,121,112,101,114,99,101,112,116,105,
-111,110,114,101,118,111,108,117,116,105,111,110,102,111,117,110,100,97,116,105,
-111,110,112,120,59,104,101,105,103,104,116,58,115,117,99,99,101,115,115,102,117,
-108,115,117,112,112,111,114,116,101,114,115,109,105,108,108,101,110,110,105,117,
-109,104,105,115,32,102,97,116,104,101,114,116,104,101,32,38,113,117,111,116,59,
-110,111,45,114,101,112,101,97,116,59,99,111,109,109,101,114,99,105,97,108,105,
-110,100,117,115,116,114,105,97,108,101,110,99,111,117,114,97,103,101,100,97,109,
-111,117,110,116,32,111,102,32,117,110,111,102,102,105,99,105,97,108,101,102,102,
-105,99,105,101,110,99,121,82,101,102,101,114,101,110,99,101,115,99,111,111,114,
-100,105,110,97,116,101,100,105,115,99,108,97,105,109,101,114,101,120,112,101,100
-,105,116,105,111,110,100,101,118,101,108,111,112,105,110,103,99,97,108,99,117,
-108,97,116,101,100,115,105,109,112,108,105,102,105,101,100,108,101,103,105,116,
-105,109,97,116,101,115,117,98,115,116,114,105,110,103,40,48,34,32,99,108,97,115,
-115,61,34,99,111,109,112,108,101,116,101,108,121,105,108,108,117,115,116,114,97,
-116,101,102,105,118,101,32,121,101,97,114,115,105,110,115,116,114,117,109,101,
-110,116,80,117,98,108,105,115,104,105,110,103,49,34,32,99,108,97,115,115,61,34,
-112,115,121,99,104,111,108,111,103,121,99,111,110,102,105,100,101,110,99,101,110
-,117,109,98,101,114,32,111,102,32,97,98,115,101,110,99,101,32,111,102,102,111,99
-,117,115,101,100,32,111,110,106,111,105,110,101,100,32,116,104,101,115,116,114,
-117,99,116,117,114,101,115,112,114,101,118,105,111,117,115,108,121,62,60,47,105,
-102,114,97,109,101,62,111,110,99,101,32,97,103,97,105,110,98,117,116,32,114,97,
-116,104,101,114,105,109,109,105,103,114,97,110,116,115,111,102,32,99,111,117,114
-,115,101,44,97,32,103,114,111,117,112,32,111,102,76,105,116,101,114,97,116,117,
-114,101,85,110,108,105,107,101,32,116,104,101,60,47,97,62,38,110,98,115,112,59,
-10,102,117,110,99,116,105,111,110,32,105,116,32,119,97,115,32,116,104,101,67,111
-,110,118,101,110,116,105,111,110,97,117,116,111,109,111,98,105,108,101,80,114,
-111,116,101,115,116,97,110,116,97,103,103,114,101,115,115,105,118,101,97,102,116
-,101,114,32,116,104,101,32,83,105,109,105,108,97,114,108,121,44,34,32,47,62,60,
-47,100,105,118,62,99,111,108,108,101,99,116,105,111,110,13,10,102,117,110,99,116
-,105,111,110,118,105,115,105,98,105,108,105,116,121,116,104,101,32,117,115,101,
-32,111,102,118,111,108,117,110,116,101,101,114,115,97,116,116,114,97,99,116,105,
-111,110,117,110,100,101,114,32,116,104,101,32,116,104,114,101,97,116,101,110,101
-,100,42,60,33,91,67,68,65,84,65,91,105,109,112,111,114,116,97,110,99,101,105,110
-,32,103,101,110,101,114,97,108,116,104,101,32,108,97,116,116,101,114,60,47,102,
-111,114,109,62,10,60,47,46,105,110,100,101,120,79,102,40,39,105,32,61,32,48,59,
-32,105,32,60,100,105,102,102,101,114,101,110,99,101,100,101,118,111,116,101,100,
-32,116,111,116,114,97,100,105,116,105,111,110,115,115,101,97,114,99,104,32,102,
-111,114,117,108,116,105,109,97,116,101,108,121,116,111,117,114,110,97,109,101,
-110,116,97,116,116,114,105,98,117,116,101,115,115,111,45,99,97,108,108,101,100,
-32,125,10,60,47,115,116,121,108,101,62,101,118,97,108,117,97,116,105,111,110,101
-,109,112,104,97,115,105,122,101,100,97,99,99,101,115,115,105,98,108,101,60,47,
-115,101,99,116,105,111,110,62,115,117,99,99,101,115,115,105,111,110,97,108,111,
-110,103,32,119,105,116,104,77,101,97,110,119,104,105,108,101,44,105,110,100,117,
-115,116,114,105,101,115,60,47,97,62,60,98,114,32,47,62,104,97,115,32,98,101,99,
-111,109,101,97,115,112,101,99,116,115,32,111,102,84,101,108,101,118,105,115,105,
-111,110,115,117,102,102,105,99,105,101,110,116,98,97,115,107,101,116,98,97,108,
-108,98,111,116,104,32,115,105,100,101,115,99,111,110,116,105,110,117,105,110,103
-,97,110,32,97,114,116,105,99,108,101,60,105,109,103,32,97,108,116,61,34,97,100,
-118,101,110,116,117,114,101,115,104,105,115,32,109,111,116,104,101,114,109,97,
-110,99,104,101,115,116,101,114,112,114,105,110,99,105,112,108,101,115,112,97,114
-,116,105,99,117,108,97,114,99,111,109,109,101,110,116,97,114,121,101,102,102,101
-,99,116,115,32,111,102,100,101,99,105,100,101,100,32,116,111,34,62,60,115,116,
-114,111,110,103,62,112,117,98,108,105,115,104,101,114,115,74,111,117,114,110,97,
-108,32,111,102,100,105,102,102,105,99,117,108,116,121,102,97,99,105,108,105,116,
-97,116,101,97,99,99,101,112,116,97,98,108,101,115,116,121,108,101,46,99,115,115,
-34,9,102,117,110,99,116,105,111,110,32,105,110,110,111,118,97,116,105,111,110,62
-,67,111,112,121,114,105,103,104,116,115,105,116,117,97,116,105,111,110,115,119,
-111,117,108,100,32,104,97,118,101,98,117,115,105,110,101,115,115,101,115,68,105,
-99,116,105,111,110,97,114,121,115,116,97,116,101,109,101,110,116,115,111,102,116
-,101,110,32,117,115,101,100,112,101,114,115,105,115,116,101,110,116,105,110,32,
-74,97,110,117,97,114,121,99,111,109,112,114,105,115,105,110,103,60,47,116,105,
-116,108,101,62,10,9,100,105,112,108,111,109,97,116,105,99,99,111,110,116,97,105,
-110,105,110,103,112,101,114,102,111,114,109,105,110,103,101,120,116,101,110,115,
-105,111,110,115,109,97,121,32,110,111,116,32,98,101,99,111,110,99,101,112,116,32
-,111,102,32,111,110,99,108,105,99,107,61,34,73,116,32,105,115,32,97,108,115,111,
-102,105,110,97,110,99,105,97,108,32,109,97,107,105,110,103,32,116,104,101,76,117
-,120,101,109,98,111,117,114,103,97,100,100,105,116,105,111,110,97,108,97,114,101
-,32,99,97,108,108,101,100,101,110,103,97,103,101,100,32,105,110,34,115,99,114,
-105,112,116,34,41,59,98,117,116,32,105,116,32,119,97,115,101,108,101,99,116,114,
-111,110,105,99,111,110,115,117,98,109,105,116,61,34,10,60,33,45,45,32,69,110,100
-,32,101,108,101,99,116,114,105,99,97,108,111,102,102,105,99,105,97,108,108,121,
-115,117,103,103,101,115,116,105,111,110,116,111,112,32,111,102,32,116,104,101,
-117,110,108,105,107,101,32,116,104,101,65,117,115,116,114,97,108,105,97,110,79,
-114,105,103,105,110,97,108,108,121,114,101,102,101,114,101,110,99,101,115,10,60,
-47,104,101,97,100,62,13,10,114,101,99,111,103,110,105,115,101,100,105,110,105,
-116,105,97,108,105,122,101,108,105,109,105,116,101,100,32,116,111,65,108,101,120
-,97,110,100,114,105,97,114,101,116,105,114,101,109,101,110,116,65,100,118,101,
-110,116,117,114,101,115,102,111,117,114,32,121,101,97,114,115,10,10,38,108,116,
-59,33,45,45,32,105,110,99,114,101,97,115,105,110,103,100,101,99,111,114,97,116,
-105,111,110,104,51,32,99,108,97,115,115,61,34,111,114,105,103,105,110,115,32,111
-,102,111,98,108,105,103,97,116,105,111,110,114,101,103,117,108,97,116,105,111,
-110,99,108,97,115,115,105,102,105,101,100,40,102,117,110,99,116,105,111,110,40,
-97,100,118,97,110,116,97,103,101,115,98,101,105,110,103,32,116,104,101,32,104,
-105,115,116,111,114,105,97,110,115,60,98,97,115,101,32,104,114,101,102,114,101,
-112,101,97,116,101,100,108,121,119,105,108,108,105,110,103,32,116,111,99,111,109
-,112,97,114,97,98,108,101,100,101,115,105,103,110,97,116,101,100,110,111,109,105
-,110,97,116,105,111,110,102,117,110,99,116,105,111,110,97,108,105,110,115,105,
-100,101,32,116,104,101,114,101,118,101,108,97,116,105,111,110,101,110,100,32,111
-,102,32,116,104,101,115,32,102,111,114,32,116,104,101,32,97,117,116,104,111,114,
-105,122,101,100,114,101,102,117,115,101,100,32,116,111,116,97,107,101,32,112,108
-,97,99,101,97,117,116,111,110,111,109,111,117,115,99,111,109,112,114,111,109,105
-,115,101,112,111,108,105,116,105,99,97,108,32,114,101,115,116,97,117,114,97,110,
-116,116,119,111,32,111,102,32,116,104,101,70,101,98,114,117,97,114,121,32,50,113
-,117,97,108,105,116,121,32,111,102,115,119,102,111,98,106,101,99,116,46,117,110,
-100,101,114,115,116,97,110,100,110,101,97,114,108,121,32,97,108,108,119,114,105,
-116,116,101,110,32,98,121,105,110,116,101,114,118,105,101,119,115,34,32,119,105,
-100,116,104,61,34,49,119,105,116,104,100,114,97,119,97,108,102,108,111,97,116,58
-,108,101,102,116,105,115,32,117,115,117,97,108,108,121,99,97,110,100,105,100,97,
-116,101,115,110,101,119,115,112,97,112,101,114,115,109,121,115,116,101,114,105,
-111,117,115,68,101,112,97,114,116,109,101,110,116,98,101,115,116,32,107,110,111,
-119,110,112,97,114,108,105,97,109,101,110,116,115,117,112,112,114,101,115,115,
-101,100,99,111,110,118,101,110,105,101,110,116,114,101,109,101,109,98,101,114,
-101,100,100,105,102,102,101,114,101,110,116,32,115,121,115,116,101,109,97,116,
-105,99,104,97,115,32,108,101,100,32,116,111,112,114,111,112,97,103,97,110,100,97
-,99,111,110,116,114,111,108,108,101,100,105,110,102,108,117,101,110,99,101,115,
-99,101,114,101,109,111,110,105,97,108,112,114,111,99,108,97,105,109,101,100,80,
-114,111,116,101,99,116,105,111,110,108,105,32,99,108,97,115,115,61,34,83,99,105,
-101,110,116,105,102,105,99,99,108,97,115,115,61,34,110,111,45,116,114,97,100,101
-,109,97,114,107,115,109,111,114,101,32,116,104,97,110,32,119,105,100,101,115,112
-,114,101,97,100,76,105,98,101,114,97,116,105,111,110,116,111,111,107,32,112,108,
-97,99,101,100,97,121,32,111,102,32,116,104,101,97,115,32,108,111,110,103,32,97,
-115,105,109,112,114,105,115,111,110,101,100,65,100,100,105,116,105,111,110,97,
-108,10,60,104,101,97,100,62,10,60,109,76,97,98,111,114,97,116,111,114,121,78,111
-,118,101,109,98,101,114,32,50,101,120,99,101,112,116,105,111,110,115,73,110,100,
-117,115,116,114,105,97,108,118,97,114,105,101,116,121,32,111,102,102,108,111,97,
-116,58,32,108,101,102,68,117,114,105,110,103,32,116,104,101,97,115,115,101,115,
-115,109,101,110,116,104,97,118,101,32,98,101,101,110,32,100,101,97,108,115,32,
-119,105,116,104,83,116,97,116,105,115,116,105,99,115,111,99,99,117,114,114,101,
-110,99,101,47,117,108,62,60,47,100,105,118,62,99,108,101,97,114,102,105,120,34,
-62,116,104,101,32,112,117,98,108,105,99,109,97,110,121,32,121,101,97,114,115,119
-,104,105,99,104,32,119,101,114,101,111,118,101,114,32,116,105,109,101,44,115,121
-,110,111,110,121,109,111,117,115,99,111,110,116,101,110,116,34,62,10,112,114,101
-,115,117,109,97,98,108,121,104,105,115,32,102,97,109,105,108,121,117,115,101,114
-,65,103,101,110,116,46,117,110,101,120,112,101,99,116,101,100,105,110,99,108,117
-,100,105,110,103,32,99,104,97,108,108,101,110,103,101,100,97,32,109,105,110,111,
-114,105,116,121,117,110,100,101,102,105,110,101,100,34,98,101,108,111,110,103,
-115,32,116,111,116,97,107,101,110,32,102,114,111,109,105,110,32,79,99,116,111,98
-,101,114,112,111,115,105,116,105,111,110,58,32,115,97,105,100,32,116,111,32,98,
-101,114,101,108,105,103,105,111,117,115,32,70,101,100,101,114,97,116,105,111,110
-,32,114,111,119,115,112,97,110,61,34,111,110,108,121,32,97,32,102,101,119,109,
-101,97,110,116,32,116,104,97,116,108,101,100,32,116,111,32,116,104,101,45,45,62,
-13,10,60,100,105,118,32,60,102,105,101,108,100,115,101,116,62,65,114,99,104,98,
-105,115,104,111,112,32,99,108,97,115,115,61,34,110,111,98,101,105,110,103,32,117
-,115,101,100,97,112,112,114,111,97,99,104,101,115,112,114,105,118,105,108,101,
-103,101,115,110,111,115,99,114,105,112,116,62,10,114,101,115,117,108,116,115,32,
-105,110,109,97,121,32,98,101,32,116,104,101,69,97,115,116,101,114,32,101,103,103
-,109,101,99,104,97,110,105,115,109,115,114,101,97,115,111,110,97,98,108,101,80,
-111,112,117,108,97,116,105,111,110,67,111,108,108,101,99,116,105,111,110,115,101
-,108,101,99,116,101,100,34,62,110,111,115,99,114,105,112,116,62,13,47,105,110,
-100,101,120,46,112,104,112,97,114,114,105,118,97,108,32,111,102,45,106,115,115,
-100,107,39,41,41,59,109,97,110,97,103,101,100,32,116,111,105,110,99,111,109,112,
-108,101,116,101,99,97,115,117,97,108,116,105,101,115,99,111,109,112,108,101,116,
-105,111,110,67,104,114,105,115,116,105,97,110,115,83,101,112,116,101,109,98,101,
-114,32,97,114,105,116,104,109,101,116,105,99,112,114,111,99,101,100,117,114,101,
-115,109,105,103,104,116,32,104,97,118,101,80,114,111,100,117,99,116,105,111,110,
-105,116,32,97,112,112,101,97,114,115,80,104,105,108,111,115,111,112,104,121,102,
-114,105,101,110,100,115,104,105,112,108,101,97,100,105,110,103,32,116,111,103,
-105,118,105,110,103,32,116,104,101,116,111,119,97,114,100,32,116,104,101,103,117
-,97,114,97,110,116,101,101,100,100,111,99,117,109,101,110,116,101,100,99,111,108
-,111,114,58,35,48,48,48,118,105,100,101,111,32,103,97,109,101,99,111,109,109,105
-,115,115,105,111,110,114,101,102,108,101,99,116,105,110,103,99,104,97,110,103,
-101,32,116,104,101,97,115,115,111,99,105,97,116,101,100,115,97,110,115,45,115,
-101,114,105,102,111,110,107,101,121,112,114,101,115,115,59,32,112,97,100,100,105
-,110,103,58,72,101,32,119,97,115,32,116,104,101,117,110,100,101,114,108,121,105,
-110,103,116,121,112,105,99,97,108,108,121,32,44,32,97,110,100,32,116,104,101,32,
-115,114,99,69,108,101,109,101,110,116,115,117,99,99,101,115,115,105,118,101,115,
-105,110,99,101,32,116,104,101,32,115,104,111,117,108,100,32,98,101,32,110,101,
-116,119,111,114,107,105,110,103,97,99,99,111,117,110,116,105,110,103,117,115,101
-,32,111,102,32,116,104,101,108,111,119,101,114,32,116,104,97,110,115,104,111,119
-,115,32,116,104,97,116,60,47,115,112,97,110,62,10,9,9,99,111,109,112,108,97,105,
-110,116,115,99,111,110,116,105,110,117,111,117,115,113,117,97,110,116,105,116,
-105,101,115,97,115,116,114,111,110,111,109,101,114,104,101,32,100,105,100,32,110
-,111,116,100,117,101,32,116,111,32,105,116,115,97,112,112,108,105,101,100,32,116
-,111,97,110,32,97,118,101,114,97,103,101,101,102,102,111,114,116,115,32,116,111,
-116,104,101,32,102,117,116,117,114,101,97,116,116,101,109,112,116,32,116,111,84,
-104,101,114,101,102,111,114,101,44,99,97,112,97,98,105,108,105,116,121,82,101,
-112,117,98,108,105,99,97,110,119,97,115,32,102,111,114,109,101,100,69,108,101,99
-,116,114,111,110,105,99,107,105,108,111,109,101,116,101,114,115,99,104,97,108,
-108,101,110,103,101,115,112,117,98,108,105,115,104,105,110,103,116,104,101,32,
-102,111,114,109,101,114,105,110,100,105,103,101,110,111,117,115,100,105,114,101,
-99,116,105,111,110,115,115,117,98,115,105,100,105,97,114,121,99,111,110,115,112,
-105,114,97,99,121,100,101,116,97,105,108,115,32,111,102,97,110,100,32,105,110,32
-,116,104,101,97,102,102,111,114,100,97,98,108,101,115,117,98,115,116,97,110,99,
-101,115,114,101,97,115,111,110,32,102,111,114,99,111,110,118,101,110,116,105,111
-,110,105,116,101,109,116,121,112,101,61,34,97,98,115,111,108,117,116,101,108,121
-,115,117,112,112,111,115,101,100,108,121,114,101,109,97,105,110,101,100,32,97,97
-,116,116,114,97,99,116,105,118,101,116,114,97,118,101,108,108,105,110,103,115,
-101,112,97,114,97,116,101,108,121,102,111,99,117,115,101,115,32,111,110,101,108,
-101,109,101,110,116,97,114,121,97,112,112,108,105,99,97,98,108,101,102,111,117,
-110,100,32,116,104,97,116,115,116,121,108,101,115,104,101,101,116,109,97,110,117
-,115,99,114,105,112,116,115,116,97,110,100,115,32,102,111,114,32,110,111,45,114,
-101,112,101,97,116,40,115,111,109,101,116,105,109,101,115,67,111,109,109,101,114
-,99,105,97,108,105,110,32,65,109,101,114,105,99,97,117,110,100,101,114,116,97,
-107,101,110,113,117,97,114,116,101,114,32,111,102,97,110,32,101,120,97,109,112,
-108,101,112,101,114,115,111,110,97,108,108,121,105,110,100,101,120,46,112,104,
-112,63,60,47,98,117,116,116,111,110,62,10,112,101,114,99,101,110,116,97,103,101,
-98,101,115,116,45,107,110,111,119,110,99,114,101,97,116,105,110,103,32,97,34,32,
-100,105,114,61,34,108,116,114,76,105,101,117,116,101,110,97,110,116,10,60,100,
-105,118,32,105,100,61,34,116,104,101,121,32,119,111,117,108,100,97,98,105,108,
-105,116,121,32,111,102,109,97,100,101,32,117,112,32,111,102,110,111,116,101,100,
-32,116,104,97,116,99,108,101,97,114,32,116,104,97,116,97,114,103,117,101,32,116,
-104,97,116,116,111,32,97,110,111,116,104,101,114,99,104,105,108,100,114,101,110,
-39,115,112,117,114,112,111,115,101,32,111,102,102,111,114,109,117,108,97,116,101
-,100,98,97,115,101,100,32,117,112,111,110,116,104,101,32,114,101,103,105,111,110
-,115,117,98,106,101,99,116,32,111,102,112,97,115,115,101,110,103,101,114,115,112
-,111,115,115,101,115,115,105,111,110,46,10,10,73,110,32,116,104,101,32,66,101,
-102,111,114,101,32,116,104,101,97,102,116,101,114,119,97,114,100,115,99,117,114,
-114,101,110,116,108,121,32,97,99,114,111,115,115,32,116,104,101,115,99,105,101,
-110,116,105,102,105,99,99,111,109,109,117,110,105,116,121,46,99,97,112,105,116,
-97,108,105,115,109,105,110,32,71,101,114,109,97,110,121,114,105,103,104,116,45,
-119,105,110,103,116,104,101,32,115,121,115,116,101,109,83,111,99,105,101,116,121
-,32,111,102,112,111,108,105,116,105,99,105,97,110,100,105,114,101,99,116,105,111
-,110,58,119,101,110,116,32,111,110,32,116,111,114,101,109,111,118,97,108,32,111,
-102,32,78,101,119,32,89,111,114,107,32,97,112,97,114,116,109,101,110,116,115,105
-,110,100,105,99,97,116,105,111,110,100,117,114,105,110,103,32,116,104,101,117,
-110,108,101,115,115,32,116,104,101,104,105,115,116,111,114,105,99,97,108,104,97,
-100,32,98,101,101,110,32,97,100,101,102,105,110,105,116,105,118,101,105,110,103,
-114,101,100,105,101,110,116,97,116,116,101,110,100,97,110,99,101,67,101,110,116,
-101,114,32,102,111,114,112,114,111,109,105,110,101,110,99,101,114,101,97,100,121
-,83,116,97,116,101,115,116,114,97,116,101,103,105,101,115,98,117,116,32,105,110,
-32,116,104,101,97,115,32,112,97,114,116,32,111,102,99,111,110,115,116,105,116,
-117,116,101,99,108,97,105,109,32,116,104,97,116,108,97,98,111,114,97,116,111,114
-,121,99,111,109,112,97,116,105,98,108,101,102,97,105,108,117,114,101,32,111,102,
-44,32,115,117,99,104,32,97,115,32,98,101,103,97,110,32,119,105,116,104,117,115,
-105,110,103,32,116,104,101,32,116,111,32,112,114,111,118,105,100,101,102,101,97,
-116,117,114,101,32,111,102,102,114,111,109,32,119,104,105,99,104,47,34,32,99,108
-,97,115,115,61,34,103,101,111,108,111,103,105,99,97,108,115,101,118,101,114,97,
-108,32,111,102,100,101,108,105,98,101,114,97,116,101,105,109,112,111,114,116,97,
-110,116,32,104,111,108,100,115,32,116,104,97,116,105,110,103,38,113,117,111,116,
-59,32,118,97,108,105,103,110,61,116,111,112,116,104,101,32,71,101,114,109,97,110
-,111,117,116,115,105,100,101,32,111,102,110,101,103,111,116,105,97,116,101,100,
-104,105,115,32,99,97,114,101,101,114,115,101,112,97,114,97,116,105,111,110,105,
-100,61,34,115,101,97,114,99,104,119,97,115,32,99,97,108,108,101,100,116,104,101,
-32,102,111,117,114,116,104,114,101,99,114,101,97,116,105,111,110,111,116,104,101
-,114,32,116,104,97,110,112,114,101,118,101,110,116,105,111,110,119,104,105,108,
-101,32,116,104,101,32,101,100,117,99,97,116,105,111,110,44,99,111,110,110,101,99
-,116,105,110,103,97,99,99,117,114,97,116,101,108,121,119,101,114,101,32,98,117,
-105,108,116,119,97,115,32,107,105,108,108,101,100,97,103,114,101,101,109,101,110
-,116,115,109,117,99,104,32,109,111,114,101,32,68,117,101,32,116,111,32,116,104,
-101,119,105,100,116,104,58,32,49,48,48,115,111,109,101,32,111,116,104,101,114,75
-,105,110,103,100,111,109,32,111,102,116,104,101,32,101,110,116,105,114,101,102,
-97,109,111,117,115,32,102,111,114,116,111,32,99,111,110,110,101,99,116,111,98,
-106,101,99,116,105,118,101,115,116,104,101,32,70,114,101,110,99,104,112,101,111,
-112,108,101,32,97,110,100,102,101,97,116,117,114,101,100,34,62,105,115,32,115,97
-,105,100,32,116,111,115,116,114,117,99,116,117,114,97,108,114,101,102,101,114,
-101,110,100,117,109,109,111,115,116,32,111,102,116,101,110,97,32,115,101,112,97,
-114,97,116,101,45,62,10,60,100,105,118,32,105,100,32,79,102,102,105,99,105,97,
-108,32,119,111,114,108,100,119,105,100,101,46,97,114,105,97,45,108,97,98,101,108
-,116,104,101,32,112,108,97,110,101,116,97,110,100,32,105,116,32,119,97,115,100,
-34,32,118,97,108,117,101,61,34,108,111,111,107,105,110,103,32,97,116,98,101,110,
-101,102,105,99,105,97,108,97,114,101,32,105,110,32,116,104,101,109,111,110,105,
-116,111,114,105,110,103,114,101,112,111,114,116,101,100,108,121,116,104,101,32,
-109,111,100,101,114,110,119,111,114,107,105,110,103,32,111,110,97,108,108,111,
-119,101,100,32,116,111,119,104,101,114,101,32,116,104,101,32,105,110,110,111,118
-,97,116,105,118,101,60,47,97,62,60,47,100,105,118,62,115,111,117,110,100,116,114
-,97,99,107,115,101,97,114,99,104,70,111,114,109,116,101,110,100,32,116,111,32,98
-,101,105,110,112,117,116,32,105,100,61,34,111,112,101,110,105,110,103,32,111,102
-,114,101,115,116,114,105,99,116,101,100,97,100,111,112,116,101,100,32,98,121,97,
-100,100,114,101,115,115,105,110,103,116,104,101,111,108,111,103,105,97,110,109,
-101,116,104,111,100,115,32,111,102,118,97,114,105,97,110,116,32,111,102,67,104,
-114,105,115,116,105,97,110,32,118,101,114,121,32,108,97,114,103,101,97,117,116,
-111,109,111,116,105,118,101,98,121,32,102,97,114,32,116,104,101,114,97,110,103,
-101,32,102,114,111,109,112,117,114,115,117,105,116,32,111,102,102,111,108,108,
-111,119,32,116,104,101,98,114,111,117,103,104,116,32,116,111,105,110,32,69,110,
-103,108,97,110,100,97,103,114,101,101,32,116,104,97,116,97,99,99,117,115,101,100
-,32,111,102,99,111,109,101,115,32,102,114,111,109,112,114,101,118,101,110,116,
-105,110,103,100,105,118,32,115,116,121,108,101,61,104,105,115,32,111,114,32,104,
-101,114,116,114,101,109,101,110,100,111,117,115,102,114,101,101,100,111,109,32,
-111,102,99,111,110,99,101,114,110,105,110,103,48,32,49,101,109,32,49,101,109,59,
-66,97,115,107,101,116,98,97,108,108,47,115,116,121,108,101,46,99,115,115,97,110,
-32,101,97,114,108,105,101,114,101,118,101,110,32,97,102,116,101,114,47,34,32,116
-,105,116,108,101,61,34,46,99,111,109,47,105,110,100,101,120,116,97,107,105,110,
-103,32,116,104,101,112,105,116,116,115,98,117,114,103,104,99,111,110,116,101,110
-,116,34,62,13,60,115,99,114,105,112,116,62,40,102,116,117,114,110,101,100,32,111
-,117,116,104,97,118,105,110,103,32,116,104,101,60,47,115,112,97,110,62,13,10,32,
-111,99,99,97,115,105,111,110,97,108,98,101,99,97,117,115,101,32,105,116,115,116,
-97,114,116,101,100,32,116,111,112,104,121,115,105,99,97,108,108,121,62,60,47,100
-,105,118,62,10,32,32,99,114,101,97,116,101,100,32,98,121,67,117,114,114,101,110,
-116,108,121,44,32,98,103,99,111,108,111,114,61,34,116,97,98,105,110,100,101,120,
-61,34,100,105,115,97,115,116,114,111,117,115,65,110,97,108,121,116,105,99,115,32
-,97,108,115,111,32,104,97,115,32,97,62,60,100,105,118,32,105,100,61,34,60,47,115
-,116,121,108,101,62,10,60,99,97,108,108,101,100,32,102,111,114,115,105,110,103,
-101,114,32,97,110,100,46,115,114,99,32,61,32,34,47,47,118,105,111,108,97,116,105
-,111,110,115,116,104,105,115,32,112,111,105,110,116,99,111,110,115,116,97,110,
-116,108,121,105,115,32,108,111,99,97,116,101,100,114,101,99,111,114,100,105,110,
-103,115,100,32,102,114,111,109,32,116,104,101,110,101,100,101,114,108,97,110,100
-,115,112,111,114,116,117,103,117,195,170,115,215,162,215,145,215,168,215,153,215
-,170,217,129,216,167,216,177,216,179,219,140,100,101,115,97,114,114,111,108,108,
-111,99,111,109,101,110,116,97,114,105,111,101,100,117,99,97,99,105,195,179,110,
-115,101,112,116,105,101,109,98,114,101,114,101,103,105,115,116,114,97,100,111,
-100,105,114,101,99,99,105,195,179,110,117,98,105,99,97,99,105,195,179,110,112,
-117,98,108,105,99,105,100,97,100,114,101,115,112,117,101,115,116,97,115,114,101,
-115,117,108,116,97,100,111,115,105,109,112,111,114,116,97,110,116,101,114,101,
-115,101,114,118,97,100,111,115,97,114,116,195,173,99,117,108,111,115,100,105,102
-,101,114,101,110,116,101,115,115,105,103,117,105,101,110,116,101,115,114,101,112
-,195,186,98,108,105,99,97,115,105,116,117,97,99,105,195,179,110,109,105,110,105,
-115,116,101,114,105,111,112,114,105,118,97,99,105,100,97,100,100,105,114,101,99,
-116,111,114,105,111,102,111,114,109,97,99,105,195,179,110,112,111,98,108,97,99,
-105,195,179,110,112,114,101,115,105,100,101,110,116,101,99,111,110,116,101,110,
-105,100,111,115,97,99,99,101,115,111,114,105,111,115,116,101,99,104,110,111,114,
-97,116,105,112,101,114,115,111,110,97,108,101,115,99,97,116,101,103,111,114,195,
-173,97,101,115,112,101,99,105,97,108,101,115,100,105,115,112,111,110,105,98,108,
-101,97,99,116,117,97,108,105,100,97,100,114,101,102,101,114,101,110,99,105,97,
-118,97,108,108,97,100,111,108,105,100,98,105,98,108,105,111,116,101,99,97,114,
-101,108,97,99,105,111,110,101,115,99,97,108,101,110,100,97,114,105,111,112,111,
-108,195,173,116,105,99,97,115,97,110,116,101,114,105,111,114,101,115,100,111,99,
-117,109,101,110,116,111,115,110,97,116,117,114,97,108,101,122,97,109,97,116,101,
-114,105,97,108,101,115,100,105,102,101,114,101,110,99,105,97,101,99,111,110,195,
-179,109,105,99,97,116,114,97,110,115,112,111,114,116,101,114,111,100,114,195,173
-,103,117,101,122,112,97,114,116,105,99,105,112,97,114,101,110,99,117,101,110,116
-,114,97,110,100,105,115,99,117,115,105,195,179,110,101,115,116,114,117,99,116,
-117,114,97,102,117,110,100,97,99,105,195,179,110,102,114,101,99,117,101,110,116,
-101,115,112,101,114,109,97,110,101,110,116,101,116,111,116,97,108,109,101,110,
-116,101,208,188,208,190,208,182,208,189,208,190,208,177,209,131,208,180,208,181,
-209,130,208,188,208,190,208,182,208,181,209,130,208,178,209,128,208,181,208,188,
-209,143,209,130,208,176,208,186,208,182,208,181,209,135,209,130,208,190,208,177,
-209,139,208,177,208,190,208,187,208,181,208,181,208,190,209,135,208,181,208,189,
-209,140,209,141,209,130,208,190,208,179,208,190,208,186,208,190,208,179,208,180,
-208,176,208,191,208,190,209,129,208,187,208,181,208,178,209,129,208,181,208,179,
-208,190,209,129,208,176,208,185,209,130,208,181,209,135,208,181,209,128,208,181,
-208,183,208,188,208,190,208,179,209,131,209,130,209,129,208,176,208,185,209,130,
-208,176,208,182,208,184,208,183,208,189,208,184,208,188,208,181,208,182,208,180,
-209,131,208,177,209,131,208,180,209,131,209,130,208,159,208,190,208,184,209,129,
-208,186,208,183,208,180,208,181,209,129,209,140,208,178,208,184,208,180,208,181,
-208,190,209,129,208,178,209,143,208,183,208,184,208,189,209,131,208,182,208,189,
-208,190,209,129,208,178,208,190,208,181,208,185,208,187,209,142,208,180,208,181,
-208,185,208,191,208,190,209,128,208,189,208,190,208,188,208,189,208,190,208,179,
-208,190,208,180,208,181,209,130,208,181,208,185,209,129,208,178,208,190,208,184,
-209,133,208,191,209,128,208,176,208,178,208,176,209,130,208,176,208,186,208,190,
-208,185,208,188,208,181,209,129,209,130,208,190,208,184,208,188,208,181,208,181,
-209,130,208,182,208,184,208,183,208,189,209,140,208,190,208,180,208,189,208,190,
-208,185,208,187,209,131,209,135,209,136,208,181,208,191,208,181,209,128,208,181,
-208,180,209,135,208,176,209,129,209,130,208,184,209,135,208,176,209,129,209,130,
-209,140,209,128,208,176,208,177,208,190,209,130,208,189,208,190,208,178,209,139,
-209,133,208,191,209,128,208,176,208,178,208,190,209,129,208,190,208,177,208,190,
-208,185,208,191,208,190,209,130,208,190,208,188,208,188,208,181,208,189,208,181,
-208,181,209,135,208,184,209,129,208,187,208,181,208,189,208,190,208,178,209,139,
-208,181,209,131,209,129,208,187,209,131,208,179,208,190,208,186,208,190,208,187,
-208,190,208,189,208,176,208,183,208,176,208,180,209,130,208,176,208,186,208,190,
-208,181,209,130,208,190,208,179,208,180,208,176,208,191,208,190,209,135,209,130,
-208,184,208,159,208,190,209,129,208,187,208,181,209,130,208,176,208,186,208,184,
-208,181,208,189,208,190,208,178,209,139,208,185,209,129,209,130,208,190,208,184,
-209,130,209,130,208,176,208,186,208,184,209,133,209,129,209,128,208,176,208,183,
-209,131,208,161,208,176,208,189,208,186,209,130,209,132,208,190,209,128,209,131,
-208,188,208,154,208,190,208,179,208,180,208,176,208,186,208,189,208,184,208,179,
-208,184,209,129,208,187,208,190,208,178,208,176,208,189,208,176,209,136,208,181,
-208,185,208,189,208,176,208,185,209,130,208,184,209,129,208,178,208,190,208,184,
-208,188,209,129,208,178,209,143,208,183,209,140,208,187,209,142,208,177,208,190,
-208,185,209,135,208,176,209,129,209,130,208,190,209,129,209,128,208,181,208,180,
-208,184,208,154,209,128,208,190,208,188,208,181,208,164,208,190,209,128,209,131,
-208,188,209,128,209,139,208,189,208,186,208,181,209,129,209,130,208,176,208,187,
-208,184,208,191,208,190,208,184,209,129,208,186,209,130,209,139,209,129,209,143,
-209,135,208,188,208,181,209,129,209,143,209,134,209,134,208,181,208,189,209,130,
-209,128,209,130,209,128,209,131,208,180,208,176,209,129,208,176,208,188,209,139,
-209,133,209,128,209,139,208,189,208,186,208,176,208,157,208,190,208,178,209,139,
-208,185,209,135,208,176,209,129,208,190,208,178,208,188,208,181,209,129,209,130,
-208,176,209,132,208,184,208,187,209,140,208,188,208,188,208,176,209,128,209,130,
-208,176,209,129,209,130,209,128,208,176,208,189,208,188,208,181,209,129,209,130,
-208,181,209,130,208,181,208,186,209,129,209,130,208,189,208,176,209,136,208,184,
-209,133,208,188,208,184,208,189,209,131,209,130,208,184,208,188,208,181,208,189,
-208,184,208,184,208,188,208,181,209,142,209,130,208,189,208,190,208,188,208,181,
-209,128,208,179,208,190,209,128,208,190,208,180,209,129,208,176,208,188,208,190,
-208,188,209,141,209,130,208,190,208,188,209,131,208,186,208,190,208,189,209,134,
-208,181,209,129,208,178,208,190,208,181,208,188,208,186,208,176,208,186,208,190,
-208,185,208,144,209,128,209,133,208,184,208,178,217,133,217,134,216,170,216,175,
-217,137,216,165,216,177,216,179,216,167,217,132,216,177,216,179,216,167,217,132,
-216,169,216,167,217,132,216,185,216,167,217,133,217,131,216,170,216,168,217,135,
-216,167,216,168,216,177,216,167,217,133,216,172,216,167,217,132,217,138,217,136,
-217,133,216,167,217,132,216,181,217,136,216,177,216,172,216,175,217,138,216,175,
-216,169,216,167,217,132,216,185,216,182,217,136,216,165,216,182,216,167,217,129,
-216,169,216,167,217,132,217,130,216,179,217,133,216,167,217,132,216,185,216,167,
-216,168,216,170,216,173,217,133,217,138,217,132,217,133,217,132,217,129,216,167,
-216,170,217,133,217,132,216,170,217,130,217,137,216,170,216,185,216,175,217,138,
-217,132,216,167,217,132,216,180,216,185,216,177,216,163,216,174,216,168,216,167,
-216,177,216,170,216,183,217,136,217,138,216,177,216,185,217,132,217,138,217,131,
-217,133,216,165,216,177,217,129,216,167,217,130,216,183,217,132,216,168,216,167,
-216,170,216,167,217,132,217,132,216,186,216,169,216,170,216,177,216,170,217,138,
-216,168,216,167,217,132,217,134,216,167,216,179,216,167,217,132,216,180,217,138,
-216,174,217,133,217,134,216,170,216,175,217,138,216,167,217,132,216,185,216,177,
-216,168,216,167,217,132,217,130,216,181,216,181,216,167,217,129,217,132,216,167,
-217,133,216,185,217,132,217,138,217,135,216,167,216,170,216,173,216,175,217,138,
-216,171,216,167,217,132,217,132,217,135,217,133,216,167,217,132,216,185,217,133,
-217,132,217,133,217,131,216,170,216,168,216,169,217,138,217,133,217,131,217,134,
-217,131,216,167,217,132,216,183,217,129,217,132,217,129,217,138,216,175,217,138,
-217,136,216,165,216,175,216,167,216,177,216,169,216,170,216,167,216,177,217,138,
-216,174,216,167,217,132,216,181,216,173,216,169,216,170,216,179,216,172,217,138,
-217,132,216,167,217,132,217,136,217,130,216,170,216,185,217,134,216,175,217,133,
-216,167,217,133,216,175,217,138,217,134,216,169,216,170,216,181,217,133,217,138,
-217,133,216,163,216,177,216,180,217,138,217,129,216,167,217,132,216,176,217,138,
-217,134,216,185,216,177,216,168,217,138,216,169,216,168,217,136,216,167,216,168,
-216,169,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,179,217,129,
-216,177,217,133,216,180,216,167,217,131,217,132,216,170,216,185,216,167,217,132,
-217,137,216,167,217,132,216,163,217,136,217,132,216,167,217,132,216,179,217,134,
-216,169,216,172,216,167,217,133,216,185,216,169,216,167,217,132,216,181,216,173,
-217,129,216,167,217,132,216,175,217,138,217,134,217,131,217,132,217,133,216,167,
-216,170,216,167,217,132,216,174,216,167,216,181,216,167,217,132,217,133,217,132,
-217,129,216,163,216,185,216,182,216,167,216,161,217,131,216,170,216,167,216,168,
-216,169,216,167,217,132,216,174,217,138,216,177,216,177,216,179,216,167,216,166,
-217,132,216,167,217,132,217,130,217,132,216,168,216,167,217,132,216,163,216,175,
-216,168,217,133,217,130,216,167,216,183,216,185,217,133,216,177,216,167,216,179,
-217,132,217,133,217,134,216,183,217,130,216,169,216,167,217,132,217,131,216,170,
-216,168,216,167,217,132,216,177,216,172,217,132,216,167,216,180,216,170,216,177,
-217,131,216,167,217,132,217,130,216,175,217,133,217,138,216,185,216,183,217,138,
-217,131,115,66,121,84,97,103,78,97,109,101,40,46,106,112,103,34,32,97,108,116,61
-,34,49,112,120,32,115,111,108,105,100,32,35,46,103,105,102,34,32,97,108,116,61,
-34,116,114,97,110,115,112,97,114,101,110,116,105,110,102,111,114,109,97,116,105,
-111,110,97,112,112,108,105,99,97,116,105,111,110,34,32,111,110,99,108,105,99,107
-,61,34,101,115,116,97,98,108,105,115,104,101,100,97,100,118,101,114,116,105,115,
-105,110,103,46,112,110,103,34,32,97,108,116,61,34,101,110,118,105,114,111,110,
-109,101,110,116,112,101,114,102,111,114,109,97,110,99,101,97,112,112,114,111,112
-,114,105,97,116,101,38,97,109,112,59,109,100,97,115,104,59,105,109,109,101,100,
-105,97,116,101,108,121,60,47,115,116,114,111,110,103,62,60,47,114,97,116,104,101
-,114,32,116,104,97,110,116,101,109,112,101,114,97,116,117,114,101,100,101,118,
-101,108,111,112,109,101,110,116,99,111,109,112,101,116,105,116,105,111,110,112,
-108,97,99,101,104,111,108,100,101,114,118,105,115,105,98,105,108,105,116,121,58,
-99,111,112,121,114,105,103,104,116,34,62,48,34,32,104,101,105,103,104,116,61,34,
-101,118,101,110,32,116,104,111,117,103,104,114,101,112,108,97,99,101,109,101,110
-,116,100,101,115,116,105,110,97,116,105,111,110,67,111,114,112,111,114,97,116,
-105,111,110,60,117,108,32,99,108,97,115,115,61,34,65,115,115,111,99,105,97,116,
-105,111,110,105,110,100,105,118,105,100,117,97,108,115,112,101,114,115,112,101,
-99,116,105,118,101,115,101,116,84,105,109,101,111,117,116,40,117,114,108,40,104,
-116,116,112,58,47,47,109,97,116,104,101,109,97,116,105,99,115,109,97,114,103,105
-,110,45,116,111,112,58,101,118,101,110,116,117,97,108,108,121,32,100,101,115,99,
-114,105,112,116,105,111,110,41,32,110,111,45,114,101,112,101,97,116,99,111,108,
-108,101,99,116,105,111,110,115,46,74,80,71,124,116,104,117,109,98,124,112,97,114
-,116,105,99,105,112,97,116,101,47,104,101,97,100,62,60,98,111,100,121,102,108,
-111,97,116,58,108,101,102,116,59,60,108,105,32,99,108,97,115,115,61,34,104,117,
-110,100,114,101,100,115,32,111,102,10,10,72,111,119,101,118,101,114,44,32,99,111
-,109,112,111,115,105,116,105,111,110,99,108,101,97,114,58,98,111,116,104,59,99,
-111,111,112,101,114,97,116,105,111,110,119,105,116,104,105,110,32,116,104,101,32
-,108,97,98,101,108,32,102,111,114,61,34,98,111,114,100,101,114,45,116,111,112,58
-,78,101,119,32,90,101,97,108,97,110,100,114,101,99,111,109,109,101,110,100,101,
-100,112,104,111,116,111,103,114,97,112,104,121,105,110,116,101,114,101,115,116,
-105,110,103,38,108,116,59,115,117,112,38,103,116,59,99,111,110,116,114,111,118,
-101,114,115,121,78,101,116,104,101,114,108,97,110,100,115,97,108,116,101,114,110
-,97,116,105,118,101,109,97,120,108,101,110,103,116,104,61,34,115,119,105,116,122
-,101,114,108,97,110,100,68,101,118,101,108,111,112,109,101,110,116,101,115,115,
-101,110,116,105,97,108,108,121,10,10,65,108,116,104,111,117,103,104,32,60,47,116
-,101,120,116,97,114,101,97,62,116,104,117,110,100,101,114,98,105,114,100,114,101
-,112,114,101,115,101,110,116,101,100,38,97,109,112,59,110,100,97,115,104,59,115,
-112,101,99,117,108,97,116,105,111,110,99,111,109,109,117,110,105,116,105,101,115
-,108,101,103,105,115,108,97,116,105,111,110,101,108,101,99,116,114,111,110,105,
-99,115,10,9,60,100,105,118,32,105,100,61,34,105,108,108,117,115,116,114,97,116,
-101,100,101,110,103,105,110,101,101,114,105,110,103,116,101,114,114,105,116,111,
-114,105,101,115,97,117,116,104,111,114,105,116,105,101,115,100,105,115,116,114,
-105,98,117,116,101,100,54,34,32,104,101,105,103,104,116,61,34,115,97,110,115,45,
-115,101,114,105,102,59,99,97,112,97,98,108,101,32,111,102,32,100,105,115,97,112,
-112,101,97,114,101,100,105,110,116,101,114,97,99,116,105,118,101,108,111,111,107
-,105,110,103,32,102,111,114,105,116,32,119,111,117,108,100,32,98,101,65,102,103,
-104,97,110,105,115,116,97,110,119,97,115,32,99,114,101,97,116,101,100,77,97,116,
-104,46,102,108,111,111,114,40,115,117,114,114,111,117,110,100,105,110,103,99,97,
-110,32,97,108,115,111,32,98,101,111,98,115,101,114,118,97,116,105,111,110,109,97
-,105,110,116,101,110,97,110,99,101,101,110,99,111,117,110,116,101,114,101,100,60
-,104,50,32,99,108,97,115,115,61,34,109,111,114,101,32,114,101,99,101,110,116,105
-,116,32,104,97,115,32,98,101,101,110,105,110,118,97,115,105,111,110,32,111,102,
-41,46,103,101,116,84,105,109,101,40,41,102,117,110,100,97,109,101,110,116,97,108
-,68,101,115,112,105,116,101,32,116,104,101,34,62,60,100,105,118,32,105,100,61,34
-,105,110,115,112,105,114,97,116,105,111,110,101,120,97,109,105,110,97,116,105,
-111,110,112,114,101,112,97,114,97,116,105,111,110,101,120,112,108,97,110,97,116,
-105,111,110,60,105,110,112,117,116,32,105,100,61,34,60,47,97,62,60,47,115,112,97
-,110,62,118,101,114,115,105,111,110,115,32,111,102,105,110,115,116,114,117,109,
-101,110,116,115,98,101,102,111,114,101,32,116,104,101,32,32,61,32,39,104,116,116
-,112,58,47,47,68,101,115,99,114,105,112,116,105,111,110,114,101,108,97,116,105,
-118,101,108,121,32,46,115,117,98,115,116,114,105,110,103,40,101,97,99,104,32,111
-,102,32,116,104,101,101,120,112,101,114,105,109,101,110,116,115,105,110,102,108,
-117,101,110,116,105,97,108,105,110,116,101,103,114,97,116,105,111,110,109,97,110
-,121,32,112,101,111,112,108,101,100,117,101,32,116,111,32,116,104,101,32,99,111,
-109,98,105,110,97,116,105,111,110,100,111,32,110,111,116,32,104,97,118,101,77,
-105,100,100,108,101,32,69,97,115,116,60,110,111,115,99,114,105,112,116,62,60,99,
-111,112,121,114,105,103,104,116,34,32,112,101,114,104,97,112,115,32,116,104,101,
-105,110,115,116,105,116,117,116,105,111,110,105,110,32,68,101,99,101,109,98,101,
-114,97,114,114,97,110,103,101,109,101,110,116,109,111,115,116,32,102,97,109,111,
-117,115,112,101,114,115,111,110,97,108,105,116,121,99,114,101,97,116,105,111,110
-,32,111,102,108,105,109,105,116,97,116,105,111,110,115,101,120,99,108,117,115,
-105,118,101,108,121,115,111,118,101,114,101,105,103,110,116,121,45,99,111,110,
-116,101,110,116,34,62,10,60,116,100,32,99,108,97,115,115,61,34,117,110,100,101,
-114,103,114,111,117,110,100,112,97,114,97,108,108,101,108,32,116,111,100,111,99,
-116,114,105,110,101,32,111,102,111,99,99,117,112,105,101,100,32,98,121,116,101,
-114,109,105,110,111,108,111,103,121,82,101,110,97,105,115,115,97,110,99,101,97,
-32,110,117,109,98,101,114,32,111,102,115,117,112,112,111,114,116,32,102,111,114,
-101,120,112,108,111,114,97,116,105,111,110,114,101,99,111,103,110,105,116,105,
-111,110,112,114,101,100,101,99,101,115,115,111,114,60,105,109,103,32,115,114,99,
-61,34,47,60,104,49,32,99,108,97,115,115,61,34,112,117,98,108,105,99,97,116,105,
-111,110,109,97,121,32,97,108,115,111,32,98,101,115,112,101,99,105,97,108,105,122
-,101,100,60,47,102,105,101,108,100,115,101,116,62,112,114,111,103,114,101,115,
-115,105,118,101,109,105,108,108,105,111,110,115,32,111,102,115,116,97,116,101,
-115,32,116,104,97,116,101,110,102,111,114,99,101,109,101,110,116,97,114,111,117,
-110,100,32,116,104,101,32,111,110,101,32,97,110,111,116,104,101,114,46,112,97,
-114,101,110,116,78,111,100,101,97,103,114,105,99,117,108,116,117,114,101,65,108,
-116,101,114,110,97,116,105,118,101,114,101,115,101,97,114,99,104,101,114,115,116
-,111,119,97,114,100,115,32,116,104,101,77,111,115,116,32,111,102,32,116,104,101,
-109,97,110,121,32,111,116,104,101,114,32,40,101,115,112,101,99,105,97,108,108,
-121,60,116,100,32,119,105,100,116,104,61,34,59,119,105,100,116,104,58,49,48,48,
-37,105,110,100,101,112,101,110,100,101,110,116,60,104,51,32,99,108,97,115,115,61
-,34,32,111,110,99,104,97,110,103,101,61,34,41,46,97,100,100,67,108,97,115,115,40
-,105,110,116,101,114,97,99,116,105,111,110,79,110,101,32,111,102,32,116,104,101,
-32,100,97,117,103,104,116,101,114,32,111,102,97,99,99,101,115,115,111,114,105,
-101,115,98,114,97,110,99,104,101,115,32,111,102,13,10,60,100,105,118,32,105,100,
-61,34,116,104,101,32,108,97,114,103,101,115,116,100,101,99,108,97,114,97,116,105
-,111,110,114,101,103,117,108,97,116,105,111,110,115,73,110,102,111,114,109,97,
-116,105,111,110,116,114,97,110,115,108,97,116,105,111,110,100,111,99,117,109,101
-,110,116,97,114,121,105,110,32,111,114,100,101,114,32,116,111,34,62,10,60,104,
-101,97,100,62,10,60,34,32,104,101,105,103,104,116,61,34,49,97,99,114,111,115,115
-,32,116,104,101,32,111,114,105,101,110,116,97,116,105,111,110,41,59,60,47,115,99
-,114,105,112,116,62,105,109,112,108,101,109,101,110,116,101,100,99,97,110,32,98,
-101,32,115,101,101,110,116,104,101,114,101,32,119,97,115,32,97,100,101,109,111,
-110,115,116,114,97,116,101,99,111,110,116,97,105,110,101,114,34,62,99,111,110,
-110,101,99,116,105,111,110,115,116,104,101,32,66,114,105,116,105,115,104,119,97,
-115,32,119,114,105,116,116,101,110,33,105,109,112,111,114,116,97,110,116,59,112,
-120,59,32,109,97,114,103,105,110,45,102,111,108,108,111,119,101,100,32,98,121,97
-,98,105,108,105,116,121,32,116,111,32,99,111,109,112,108,105,99,97,116,101,100,
-100,117,114,105,110,103,32,116,104,101,32,105,109,109,105,103,114,97,116,105,111
-,110,97,108,115,111,32,99,97,108,108,101,100,60,104,52,32,99,108,97,115,115,61,
-34,100,105,115,116,105,110,99,116,105,111,110,114,101,112,108,97,99,101,100,32,
-98,121,103,111,118,101,114,110,109,101,110,116,115,108,111,99,97,116,105,111,110
-,32,111,102,105,110,32,78,111,118,101,109,98,101,114,119,104,101,116,104,101,114
-,32,116,104,101,60,47,112,62,10,60,47,100,105,118,62,97,99,113,117,105,115,105,
-116,105,111,110,99,97,108,108,101,100,32,116,104,101,32,112,101,114,115,101,99,
-117,116,105,111,110,100,101,115,105,103,110,97,116,105,111,110,123,102,111,110,
-116,45,115,105,122,101,58,97,112,112,101,97,114,101,100,32,105,110,105,110,118,
-101,115,116,105,103,97,116,101,101,120,112,101,114,105,101,110,99,101,100,109,
-111,115,116,32,108,105,107,101,108,121,119,105,100,101,108,121,32,117,115,101,
-100,100,105,115,99,117,115,115,105,111,110,115,112,114,101,115,101,110,99,101,32
-,111,102,32,40,100,111,99,117,109,101,110,116,46,101,120,116,101,110,115,105,118
-,101,108,121,73,116,32,104,97,115,32,98,101,101,110,105,116,32,100,111,101,115,
-32,110,111,116,99,111,110,116,114,97,114,121,32,116,111,105,110,104,97,98,105,
-116,97,110,116,115,105,109,112,114,111,118,101,109,101,110,116,115,99,104,111,
-108,97,114,115,104,105,112,99,111,110,115,117,109,112,116,105,111,110,105,110,
-115,116,114,117,99,116,105,111,110,102,111,114,32,101,120,97,109,112,108,101,111
-,110,101,32,111,114,32,109,111,114,101,112,120,59,32,112,97,100,100,105,110,103,
-116,104,101,32,99,117,114,114,101,110,116,97,32,115,101,114,105,101,115,32,111,
-102,97,114,101,32,117,115,117,97,108,108,121,114,111,108,101,32,105,110,32,116,
-104,101,112,114,101,118,105,111,117,115,108,121,32,100,101,114,105,118,97,116,
-105,118,101,115,101,118,105,100,101,110,99,101,32,111,102,101,120,112,101,114,
-105,101,110,99,101,115,99,111,108,111,114,115,99,104,101,109,101,115,116,97,116,
-101,100,32,116,104,97,116,99,101,114,116,105,102,105,99,97,116,101,60,47,97,62,
-60,47,100,105,118,62,10,32,115,101,108,101,99,116,101,100,61,34,104,105,103,104,
-32,115,99,104,111,111,108,114,101,115,112,111,110,115,101,32,116,111,99,111,109,
-102,111,114,116,97,98,108,101,97,100,111,112,116,105,111,110,32,111,102,116,104,
-114,101,101,32,121,101,97,114,115,116,104,101,32,99,111,117,110,116,114,121,105,
-110,32,70,101,98,114,117,97,114,121,115,111,32,116,104,97,116,32,116,104,101,112
-,101,111,112,108,101,32,119,104,111,32,112,114,111,118,105,100,101,100,32,98,121
-,60,112,97,114,97,109,32,110,97,109,101,97,102,102,101,99,116,101,100,32,98,121,
-105,110,32,116,101,114,109,115,32,111,102,97,112,112,111,105,110,116,109,101,110
-,116,73,83,79,45,56,56,53,57,45,49,34,119,97,115,32,98,111,114,110,32,105,110,
-104,105,115,116,111,114,105,99,97,108,32,114,101,103,97,114,100,101,100,32,97,
-115,109,101,97,115,117,114,101,109,101,110,116,105,115,32,98,97,115,101,100,32,
-111,110,32,97,110,100,32,111,116,104,101,114,32,58,32,102,117,110,99,116,105,111
-,110,40,115,105,103,110,105,102,105,99,97,110,116,99,101,108,101,98,114,97,116,
-105,111,110,116,114,97,110,115,109,105,116,116,101,100,47,106,115,47,106,113,117
-,101,114,121,46,105,115,32,107,110,111,119,110,32,97,115,116,104,101,111,114,101
-,116,105,99,97,108,32,116,97,98,105,110,100,101,120,61,34,105,116,32,99,111,117,
-108,100,32,98,101,60,110,111,115,99,114,105,112,116,62,10,104,97,118,105,110,103
-,32,98,101,101,110,13,10,60,104,101,97,100,62,13,10,60,32,38,113,117,111,116,59,
-84,104,101,32,99,111,109,112,105,108,97,116,105,111,110,104,101,32,104,97,100,32
-,98,101,101,110,112,114,111,100,117,99,101,100,32,98,121,112,104,105,108,111,115
-,111,112,104,101,114,99,111,110,115,116,114,117,99,116,101,100,105,110,116,101,
-110,100,101,100,32,116,111,97,109,111,110,103,32,111,116,104,101,114,99,111,109,
-112,97,114,101,100,32,116,111,116,111,32,115,97,121,32,116,104,97,116,69,110,103
-,105,110,101,101,114,105,110,103,97,32,100,105,102,102,101,114,101,110,116,114,
-101,102,101,114,114,101,100,32,116,111,100,105,102,102,101,114,101,110,99,101,
-115,98,101,108,105,101,102,32,116,104,97,116,112,104,111,116,111,103,114,97,112,
-104,115,105,100,101,110,116,105,102,121,105,110,103,72,105,115,116,111,114,121,
-32,111,102,32,82,101,112,117,98,108,105,99,32,111,102,110,101,99,101,115,115,97,
-114,105,108,121,112,114,111,98,97,98,105,108,105,116,121,116,101,99,104,110,105,
-99,97,108,108,121,108,101,97,118,105,110,103,32,116,104,101,115,112,101,99,116,
-97,99,117,108,97,114,102,114,97,99,116,105,111,110,32,111,102,101,108,101,99,116
-,114,105,99,105,116,121,104,101,97,100,32,111,102,32,116,104,101,114,101,115,116
-,97,117,114,97,110,116,115,112,97,114,116,110,101,114,115,104,105,112,101,109,
-112,104,97,115,105,115,32,111,110,109,111,115,116,32,114,101,99,101,110,116,115,
-104,97,114,101,32,119,105,116,104,32,115,97,121,105,110,103,32,116,104,97,116,
-102,105,108,108,101,100,32,119,105,116,104,100,101,115,105,103,110,101,100,32,
-116,111,105,116,32,105,115,32,111,102,116,101,110,34,62,60,47,105,102,114,97,109
-,101,62,97,115,32,102,111,108,108,111,119,115,58,109,101,114,103,101,100,32,119,
-105,116,104,116,104,114,111,117,103,104,32,116,104,101,99,111,109,109,101,114,99
-,105,97,108,32,112,111,105,110,116,101,100,32,111,117,116,111,112,112,111,114,
-116,117,110,105,116,121,118,105,101,119,32,111,102,32,116,104,101,114,101,113,
-117,105,114,101,109,101,110,116,100,105,118,105,115,105,111,110,32,111,102,112,
-114,111,103,114,97,109,109,105,110,103,104,101,32,114,101,99,101,105,118,101,100
-,115,101,116,73,110,116,101,114,118,97,108,34,62,60,47,115,112,97,110,62,60,47,
-105,110,32,78,101,119,32,89,111,114,107,97,100,100,105,116,105,111,110,97,108,32
-,99,111,109,112,114,101,115,115,105,111,110,10,10,60,100,105,118,32,105,100,61,
-34,105,110,99,111,114,112,111,114,97,116,101,59,60,47,115,99,114,105,112,116,62,
-60,97,116,116,97,99,104,69,118,101,110,116,98,101,99,97,109,101,32,116,104,101,
-32,34,32,116,97,114,103,101,116,61,34,95,99,97,114,114,105,101,100,32,111,117,
-116,83,111,109,101,32,111,102,32,116,104,101,115,99,105,101,110,99,101,32,97,110
-,100,116,104,101,32,116,105,109,101,32,111,102,67,111,110,116,97,105,110,101,114
-,34,62,109,97,105,110,116,97,105,110,105,110,103,67,104,114,105,115,116,111,112,
-104,101,114,77,117,99,104,32,111,102,32,116,104,101,119,114,105,116,105,110,103,
-115,32,111,102,34,32,104,101,105,103,104,116,61,34,50,115,105,122,101,32,111,102
-,32,116,104,101,118,101,114,115,105,111,110,32,111,102,32,109,105,120,116,117,
-114,101,32,111,102,32,98,101,116,119,101,101,110,32,116,104,101,69,120,97,109,
-112,108,101,115,32,111,102,101,100,117,99,97,116,105,111,110,97,108,99,111,109,
-112,101,116,105,116,105,118,101,32,111,110,115,117,98,109,105,116,61,34,100,105,
-114,101,99,116,111,114,32,111,102,100,105,115,116,105,110,99,116,105,118,101,47,
-68,84,68,32,88,72,84,77,76,32,114,101,108,97,116,105,110,103,32,116,111,116,101,
-110,100,101,110,99,121,32,116,111,112,114,111,118,105,110,99,101,32,111,102,119,
-104,105,99,104,32,119,111,117,108,100,100,101,115,112,105,116,101,32,116,104,101
-,115,99,105,101,110,116,105,102,105,99,32,108,101,103,105,115,108,97,116,117,114
-,101,46,105,110,110,101,114,72,84,77,76,32,97,108,108,101,103,97,116,105,111,110
-,115,65,103,114,105,99,117,108,116,117,114,101,119,97,115,32,117,115,101,100,32,
-105,110,97,112,112,114,111,97,99,104,32,116,111,105,110,116,101,108,108,105,103,
-101,110,116,121,101,97,114,115,32,108,97,116,101,114,44,115,97,110,115,45,115,
-101,114,105,102,100,101,116,101,114,109,105,110,105,110,103,80,101,114,102,111,
-114,109,97,110,99,101,97,112,112,101,97,114,97,110,99,101,115,44,32,119,104,105,
-99,104,32,105,115,32,102,111,117,110,100,97,116,105,111,110,115,97,98,98,114,101
-,118,105,97,116,101,100,104,105,103,104,101,114,32,116,104,97,110,115,32,102,114
-,111,109,32,116,104,101,32,105,110,100,105,118,105,100,117,97,108,32,99,111,109,
-112,111,115,101,100,32,111,102,115,117,112,112,111,115,101,100,32,116,111,99,108
-,97,105,109,115,32,116,104,97,116,97,116,116,114,105,98,117,116,105,111,110,102,
-111,110,116,45,115,105,122,101,58,49,101,108,101,109,101,110,116,115,32,111,102,
-72,105,115,116,111,114,105,99,97,108,32,104,105,115,32,98,114,111,116,104,101,
-114,97,116,32,116,104,101,32,116,105,109,101,97,110,110,105,118,101,114,115,97,
-114,121,103,111,118,101,114,110,101,100,32,98,121,114,101,108,97,116,101,100,32,
-116,111,32,117,108,116,105,109,97,116,101,108,121,32,105,110,110,111,118,97,116,
-105,111,110,115,105,116,32,105,115,32,115,116,105,108,108,99,97,110,32,111,110,
-108,121,32,98,101,100,101,102,105,110,105,116,105,111,110,115,116,111,71,77,84,
-83,116,114,105,110,103,65,32,110,117,109,98,101,114,32,111,102,105,109,103,32,99
-,108,97,115,115,61,34,69,118,101,110,116,117,97,108,108,121,44,119,97,115,32,99,
-104,97,110,103,101,100,111,99,99,117,114,114,101,100,32,105,110,110,101,105,103,
-104,98,111,114,105,110,103,100,105,115,116,105,110,103,117,105,115,104,119,104,
-101,110,32,104,101,32,119,97,115,105,110,116,114,111,100,117,99,105,110,103,116,
-101,114,114,101,115,116,114,105,97,108,77,97,110,121,32,111,102,32,116,104,101,
-97,114,103,117,101,115,32,116,104,97,116,97,110,32,65,109,101,114,105,99,97,110,
-99,111,110,113,117,101,115,116,32,111,102,119,105,100,101,115,112,114,101,97,100
-,32,119,101,114,101,32,107,105,108,108,101,100,115,99,114,101,101,110,32,97,110,
-100,32,73,110,32,111,114,100,101,114,32,116,111,101,120,112,101,99,116,101,100,
-32,116,111,100,101,115,99,101,110,100,97,110,116,115,97,114,101,32,108,111,99,97
-,116,101,100,108,101,103,105,115,108,97,116,105,118,101,103,101,110,101,114,97,
-116,105,111,110,115,32,98,97,99,107,103,114,111,117,110,100,109,111,115,116,32,
-112,101,111,112,108,101,121,101,97,114,115,32,97,102,116,101,114,116,104,101,114
-,101,32,105,115,32,110,111,116,104,101,32,104,105,103,104,101,115,116,102,114,
-101,113,117,101,110,116,108,121,32,116,104,101,121,32,100,111,32,110,111,116,97,
-114,103,117,101,100,32,116,104,97,116,115,104,111,119,101,100,32,116,104,97,116,
-112,114,101,100,111,109,105,110,97,110,116,116,104,101,111,108,111,103,105,99,97
-,108,98,121,32,116,104,101,32,116,105,109,101,99,111,110,115,105,100,101,114,105
-,110,103,115,104,111,114,116,45,108,105,118,101,100,60,47,115,112,97,110,62,60,
-47,97,62,99,97,110,32,98,101,32,117,115,101,100,118,101,114,121,32,108,105,116,
-116,108,101,111,110,101,32,111,102,32,116,104,101,32,104,97,100,32,97,108,114,
-101,97,100,121,105,110,116,101,114,112,114,101,116,101,100,99,111,109,109,117,
-110,105,99,97,116,101,102,101,97,116,117,114,101,115,32,111,102,103,111,118,101,
-114,110,109,101,110,116,44,60,47,110,111,115,99,114,105,112,116,62,101,110,116,
-101,114,101,100,32,116,104,101,34,32,104,101,105,103,104,116,61,34,51,73,110,100
-,101,112,101,110,100,101,110,116,112,111,112,117,108,97,116,105,111,110,115,108,
-97,114,103,101,45,115,99,97,108,101,46,32,65,108,116,104,111,117,103,104,32,117,
-115,101,100,32,105,110,32,116,104,101,100,101,115,116,114,117,99,116,105,111,110
-,112,111,115,115,105,98,105,108,105,116,121,115,116,97,114,116,105,110,103,32,
-105,110,116,119,111,32,111,114,32,109,111,114,101,101,120,112,114,101,115,115,
-105,111,110,115,115,117,98,111,114,100,105,110,97,116,101,108,97,114,103,101,114
-,32,116,104,97,110,104,105,115,116,111,114,121,32,97,110,100,60,47,111,112,116,
-105,111,110,62,13,10,67,111,110,116,105,110,101,110,116,97,108,101,108,105,109,
-105,110,97,116,105,110,103,119,105,108,108,32,110,111,116,32,98,101,112,114,97,
-99,116,105,99,101,32,111,102,105,110,32,102,114,111,110,116,32,111,102,115,105,
-116,101,32,111,102,32,116,104,101,101,110,115,117,114,101,32,116,104,97,116,116,
-111,32,99,114,101,97,116,101,32,97,109,105,115,115,105,115,115,105,112,112,105,
-112,111,116,101,110,116,105,97,108,108,121,111,117,116,115,116,97,110,100,105,
-110,103,98,101,116,116,101,114,32,116,104,97,110,119,104,97,116,32,105,115,32,
-110,111,119,115,105,116,117,97,116,101,100,32,105,110,109,101,116,97,32,110,97,
-109,101,61,34,84,114,97,100,105,116,105,111,110,97,108,115,117,103,103,101,115,
-116,105,111,110,115,84,114,97,110,115,108,97,116,105,111,110,116,104,101,32,102,
-111,114,109,32,111,102,97,116,109,111,115,112,104,101,114,105,99,105,100,101,111
-,108,111,103,105,99,97,108,101,110,116,101,114,112,114,105,115,101,115,99,97,108
-,99,117,108,97,116,105,110,103,101,97,115,116,32,111,102,32,116,104,101,114,101,
-109,110,97,110,116,115,32,111,102,112,108,117,103,105,110,115,112,97,103,101,47,
-105,110,100,101,120,46,112,104,112,63,114,101,109,97,105,110,101,100,32,105,110,
-116,114,97,110,115,102,111,114,109,101,100,72,101,32,119,97,115,32,97,108,115,
-111,119,97,115,32,97,108,114,101,97,100,121,115,116,97,116,105,115,116,105,99,97
-,108,105,110,32,102,97,118,111,114,32,111,102,77,105,110,105,115,116,114,121,32,
-111,102,109,111,118,101,109,101,110,116,32,111,102,102,111,114,109,117,108,97,
-116,105,111,110,105,115,32,114,101,113,117,105,114,101,100,60,108,105,110,107,32
-,114,101,108,61,34,84,104,105,115,32,105,115,32,116,104,101,32,60,97,32,104,114,
-101,102,61,34,47,112,111,112,117,108,97,114,105,122,101,100,105,110,118,111,108,
-118,101,100,32,105,110,97,114,101,32,117,115,101,100,32,116,111,97,110,100,32,
-115,101,118,101,114,97,108,109,97,100,101,32,98,121,32,116,104,101,115,101,101,
-109,115,32,116,111,32,98,101,108,105,107,101,108,121,32,116,104,97,116,80,97,108
-,101,115,116,105,110,105,97,110,110,97,109,101,100,32,97,102,116,101,114,105,116
-,32,104,97,100,32,98,101,101,110,109,111,115,116,32,99,111,109,109,111,110,116,
-111,32,114,101,102,101,114,32,116,111,98,117,116,32,116,104,105,115,32,105,115,
-99,111,110,115,101,99,117,116,105,118,101,116,101,109,112,111,114,97,114,105,108
-,121,73,110,32,103,101,110,101,114,97,108,44,99,111,110,118,101,110,116,105,111,
-110,115,116,97,107,101,115,32,112,108,97,99,101,115,117,98,100,105,118,105,115,
-105,111,110,116,101,114,114,105,116,111,114,105,97,108,111,112,101,114,97,116,
-105,111,110,97,108,112,101,114,109,97,110,101,110,116,108,121,119,97,115,32,108,
-97,114,103,101,108,121,111,117,116,98,114,101,97,107,32,111,102,105,110,32,116,
-104,101,32,112,97,115,116,102,111,108,108,111,119,105,110,103,32,97,32,120,109,
-108,110,115,58,111,103,61,34,62,60,97,32,99,108,97,115,115,61,34,99,108,97,115,
-115,61,34,116,101,120,116,67,111,110,118,101,114,115,105,111,110,32,109,97,121,
-32,98,101,32,117,115,101,100,109,97,110,117,102,97,99,116,117,114,101,97,102,116
-,101,114,32,98,101,105,110,103,99,108,101,97,114,102,105,120,34,62,10,113,117,
-101,115,116,105,111,110,32,111,102,119,97,115,32,101,108,101,99,116,101,100,116,
-111,32,98,101,99,111,109,101,32,97,98,101,99,97,117,115,101,32,111,102,32,115,
-111,109,101,32,112,101,111,112,108,101,105,110,115,112,105,114,101,100,32,98,121
-,115,117,99,99,101,115,115,102,117,108,32,97,32,116,105,109,101,32,119,104,101,
-110,109,111,114,101,32,99,111,109,109,111,110,97,109,111,110,103,115,116,32,116,
-104,101,97,110,32,111,102,102,105,99,105,97,108,119,105,100,116,104,58,49,48,48,
-37,59,116,101,99,104,110,111,108,111,103,121,44,119,97,115,32,97,100,111,112,116
-,101,100,116,111,32,107,101,101,112,32,116,104,101,115,101,116,116,108,101,109,
-101,110,116,115,108,105,118,101,32,98,105,114,116,104,115,105,110,100,101,120,46
-,104,116,109,108,34,67,111,110,110,101,99,116,105,99,117,116,97,115,115,105,103,
-110,101,100,32,116,111,38,97,109,112,59,116,105,109,101,115,59,97,99,99,111,117,
-110,116,32,102,111,114,97,108,105,103,110,61,114,105,103,104,116,116,104,101,32,
-99,111,109,112,97,110,121,97,108,119,97,121,115,32,98,101,101,110,114,101,116,
-117,114,110,101,100,32,116,111,105,110,118,111,108,118,101,109,101,110,116,66,
-101,99,97,117,115,101,32,116,104,101,116,104,105,115,32,112,101,114,105,111,100,
-34,32,110,97,109,101,61,34,113,34,32,99,111,110,102,105,110,101,100,32,116,111,
-97,32,114,101,115,117,108,116,32,111,102,118,97,108,117,101,61,34,34,32,47,62,
-105,115,32,97,99,116,117,97,108,108,121,69,110,118,105,114,111,110,109,101,110,
-116,13,10,60,47,104,101,97,100,62,13,10,67,111,110,118,101,114,115,101,108,121,
-44,62,10,60,100,105,118,32,105,100,61,34,48,34,32,119,105,100,116,104,61,34,49,
-105,115,32,112,114,111,98,97,98,108,121,104,97,118,101,32,98,101,99,111,109,101,
-99,111,110,116,114,111,108,108,105,110,103,116,104,101,32,112,114,111,98,108,101
-,109,99,105,116,105,122,101,110,115,32,111,102,112,111,108,105,116,105,99,105,97
-,110,115,114,101,97,99,104,101,100,32,116,104,101,97,115,32,101,97,114,108,121,
-32,97,115,58,110,111,110,101,59,32,111,118,101,114,60,116,97,98,108,101,32,99,
-101,108,108,118,97,108,105,100,105,116,121,32,111,102,100,105,114,101,99,116,108
-,121,32,116,111,111,110,109,111,117,115,101,100,111,119,110,119,104,101,114,101,
-32,105,116,32,105,115,119,104,101,110,32,105,116,32,119,97,115,109,101,109,98,
-101,114,115,32,111,102,32,114,101,108,97,116,105,111,110,32,116,111,97,99,99,111
-,109,109,111,100,97,116,101,97,108,111,110,103,32,119,105,116,104,32,73,110,32,
-116,104,101,32,108,97,116,101,116,104,101,32,69,110,103,108,105,115,104,100,101,
-108,105,99,105,111,117,115,34,62,116,104,105,115,32,105,115,32,110,111,116,116,
-104,101,32,112,114,101,115,101,110,116,105,102,32,116,104,101,121,32,97,114,101,
-97,110,100,32,102,105,110,97,108,108,121,97,32,109,97,116,116,101,114,32,111,102
-,13,10,9,60,47,100,105,118,62,13,10,13,10,60,47,115,99,114,105,112,116,62,102,97
-,115,116,101,114,32,116,104,97,110,109,97,106,111,114,105,116,121,32,111,102,97,
-102,116,101,114,32,119,104,105,99,104,99,111,109,112,97,114,97,116,105,118,101,
-116,111,32,109,97,105,110,116,97,105,110,105,109,112,114,111,118,101,32,116,104,
-101,97,119,97,114,100,101,100,32,116,104,101,101,114,34,32,99,108,97,115,115,61,
-34,102,114,97,109,101,98,111,114,100,101,114,114,101,115,116,111,114,97,116,105,
-111,110,105,110,32,116,104,101,32,115,97,109,101,97,110,97,108,121,115,105,115,
-32,111,102,116,104,101,105,114,32,102,105,114,115,116,68,117,114,105,110,103,32,
-116,104,101,32,99,111,110,116,105,110,101,110,116,97,108,115,101,113,117,101,110
-,99,101,32,111,102,102,117,110,99,116,105,111,110,40,41,123,102,111,110,116,45,
-115,105,122,101,58,32,119,111,114,107,32,111,110,32,116,104,101,60,47,115,99,114
-,105,112,116,62,10,60,98,101,103,105,110,115,32,119,105,116,104,106,97,118,97,
-115,99,114,105,112,116,58,99,111,110,115,116,105,116,117,101,110,116,119,97,115,
-32,102,111,117,110,100,101,100,101,113,117,105,108,105,98,114,105,117,109,97,115
-,115,117,109,101,32,116,104,97,116,105,115,32,103,105,118,101,110,32,98,121,110,
-101,101,100,115,32,116,111,32,98,101,99,111,111,114,100,105,110,97,116,101,115,
-116,104,101,32,118,97,114,105,111,117,115,97,114,101,32,112,97,114,116,32,111,
-102,111,110,108,121,32,105,110,32,116,104,101,115,101,99,116,105,111,110,115,32,
-111,102,105,115,32,97,32,99,111,109,109,111,110,116,104,101,111,114,105,101,115,
-32,111,102,100,105,115,99,111,118,101,114,105,101,115,97,115,115,111,99,105,97,
-116,105,111,110,101,100,103,101,32,111,102,32,116,104,101,115,116,114,101,110,
-103,116,104,32,111,102,112,111,115,105,116,105,111,110,32,105,110,112,114,101,
-115,101,110,116,45,100,97,121,117,110,105,118,101,114,115,97,108,108,121,116,111
-,32,102,111,114,109,32,116,104,101,98,117,116,32,105,110,115,116,101,97,100,99,
-111,114,112,111,114,97,116,105,111,110,97,116,116,97,99,104,101,100,32,116,111,
-105,115,32,99,111,109,109,111,110,108,121,114,101,97,115,111,110,115,32,102,111,
-114,32,38,113,117,111,116,59,116,104,101,32,99,97,110,32,98,101,32,109,97,100,
-101,119,97,115,32,97,98,108,101,32,116,111,119,104,105,99,104,32,109,101,97,110,
-115,98,117,116,32,100,105,100,32,110,111,116,111,110,77,111,117,115,101,79,118,
-101,114,97,115,32,112,111,115,115,105,98,108,101,111,112,101,114,97,116,101,100,
-32,98,121,99,111,109,105,110,103,32,102,114,111,109,116,104,101,32,112,114,105,
-109,97,114,121,97,100,100,105,116,105,111,110,32,111,102,102,111,114,32,115,101,
-118,101,114,97,108,116,114,97,110,115,102,101,114,114,101,100,97,32,112,101,114,
-105,111,100,32,111,102,97,114,101,32,97,98,108,101,32,116,111,104,111,119,101,
-118,101,114,44,32,105,116,115,104,111,117,108,100,32,104,97,118,101,109,117,99,
-104,32,108,97,114,103,101,114,10,9,60,47,115,99,114,105,112,116,62,97,100,111,
-112,116,101,100,32,116,104,101,112,114,111,112,101,114,116,121,32,111,102,100,
-105,114,101,99,116,101,100,32,98,121,101,102,102,101,99,116,105,118,101,108,121,
-119,97,115,32,98,114,111,117,103,104,116,99,104,105,108,100,114,101,110,32,111,
-102,80,114,111,103,114,97,109,109,105,110,103,108,111,110,103,101,114,32,116,104
-,97,110,109,97,110,117,115,99,114,105,112,116,115,119,97,114,32,97,103,97,105,
-110,115,116,98,121,32,109,101,97,110,115,32,111,102,97,110,100,32,109,111,115,
-116,32,111,102,115,105,109,105,108,97,114,32,116,111,32,112,114,111,112,114,105,
-101,116,97,114,121,111,114,105,103,105,110,97,116,105,110,103,112,114,101,115,
-116,105,103,105,111,117,115,103,114,97,109,109,97,116,105,99,97,108,101,120,112,
-101,114,105,101,110,99,101,46,116,111,32,109,97,107,101,32,116,104,101,73,116,32
-,119,97,115,32,97,108,115,111,105,115,32,102,111,117,110,100,32,105,110,99,111,
-109,112,101,116,105,116,111,114,115,105,110,32,116,104,101,32,85,46,83,46,114,
-101,112,108,97,99,101,32,116,104,101,98,114,111,117,103,104,116,32,116,104,101,
-99,97,108,99,117,108,97,116,105,111,110,102,97,108,108,32,111,102,32,116,104,101
-,116,104,101,32,103,101,110,101,114,97,108,112,114,97,99,116,105,99,97,108,108,
-121,105,110,32,104,111,110,111,114,32,111,102,114,101,108,101,97,115,101,100,32,
-105,110,114,101,115,105,100,101,110,116,105,97,108,97,110,100,32,115,111,109,101
-,32,111,102,107,105,110,103,32,111,102,32,116,104,101,114,101,97,99,116,105,111,
-110,32,116,111,49,115,116,32,69,97,114,108,32,111,102,99,117,108,116,117,114,101
-,32,97,110,100,112,114,105,110,99,105,112,97,108,108,121,60,47,116,105,116,108,
-101,62,10,32,32,116,104,101,121,32,99,97,110,32,98,101,98,97,99,107,32,116,111,
-32,116,104,101,115,111,109,101,32,111,102,32,104,105,115,101,120,112,111,115,117
-,114,101,32,116,111,97,114,101,32,115,105,109,105,108,97,114,102,111,114,109,32,
-111,102,32,116,104,101,97,100,100,70,97,118,111,114,105,116,101,99,105,116,105,
-122,101,110,115,104,105,112,112,97,114,116,32,105,110,32,116,104,101,112,101,111
-,112,108,101,32,119,105,116,104,105,110,32,112,114,97,99,116,105,99,101,116,111,
-32,99,111,110,116,105,110,117,101,38,97,109,112,59,109,105,110,117,115,59,97,112
-,112,114,111,118,101,100,32,98,121,32,116,104,101,32,102,105,114,115,116,32,97,
-108,108,111,119,101,100,32,116,104,101,97,110,100,32,102,111,114,32,116,104,101,
-102,117,110,99,116,105,111,110,105,110,103,112,108,97,121,105,110,103,32,116,104
-,101,115,111,108,117,116,105,111,110,32,116,111,104,101,105,103,104,116,61,34,48
-,34,32,105,110,32,104,105,115,32,98,111,111,107,109,111,114,101,32,116,104,97,
-110,32,97,102,111,108,108,111,119,115,32,116,104,101,99,114,101,97,116,101,100,
-32,116,104,101,112,114,101,115,101,110,99,101,32,105,110,38,110,98,115,112,59,60
-,47,116,100,62,110,97,116,105,111,110,97,108,105,115,116,116,104,101,32,105,100,
-101,97,32,111,102,97,32,99,104,97,114,97,99,116,101,114,119,101,114,101,32,102,
-111,114,99,101,100,32,99,108,97,115,115,61,34,98,116,110,100,97,121,115,32,111,
-102,32,116,104,101,102,101,97,116,117,114,101,100,32,105,110,115,104,111,119,105
-,110,103,32,116,104,101,105,110,116,101,114,101,115,116,32,105,110,105,110,32,
-112,108,97,99,101,32,111,102,116,117,114,110,32,111,102,32,116,104,101,116,104,
-101,32,104,101,97,100,32,111,102,76,111,114,100,32,111,102,32,116,104,101,112,
-111,108,105,116,105,99,97,108,108,121,104,97,115,32,105,116,115,32,111,119,110,
-69,100,117,99,97,116,105,111,110,97,108,97,112,112,114,111,118,97,108,32,111,102
-,115,111,109,101,32,111,102,32,116,104,101,101,97,99,104,32,111,116,104,101,114,
-44,98,101,104,97,118,105,111,114,32,111,102,97,110,100,32,98,101,99,97,117,115,
-101,97,110,100,32,97,110,111,116,104,101,114,97,112,112,101,97,114,101,100,32,
-111,110,114,101,99,111,114,100,101,100,32,105,110,98,108,97,99,107,38,113,117,
-111,116,59,109,97,121,32,105,110,99,108,117,100,101,116,104,101,32,119,111,114,
-108,100,39,115,99,97,110,32,108,101,97,100,32,116,111,114,101,102,101,114,115,32
-,116,111,32,97,98,111,114,100,101,114,61,34,48,34,32,103,111,118,101,114,110,109
-,101,110,116,32,119,105,110,110,105,110,103,32,116,104,101,114,101,115,117,108,
-116,101,100,32,105,110,32,119,104,105,108,101,32,116,104,101,32,87,97,115,104,
-105,110,103,116,111,110,44,116,104,101,32,115,117,98,106,101,99,116,99,105,116,
-121,32,105,110,32,116,104,101,62,60,47,100,105,118,62,13,10,9,9,114,101,102,108,
-101,99,116,32,116,104,101,116,111,32,99,111,109,112,108,101,116,101,98,101,99,97
-,109,101,32,109,111,114,101,114,97,100,105,111,97,99,116,105,118,101,114,101,106
-,101,99,116,101,100,32,98,121,119,105,116,104,111,117,116,32,97,110,121,104,105,
-115,32,102,97,116,104,101,114,44,119,104,105,99,104,32,99,111,117,108,100,99,111
-,112,121,32,111,102,32,116,104,101,116,111,32,105,110,100,105,99,97,116,101,97,
-32,112,111,108,105,116,105,99,97,108,97,99,99,111,117,110,116,115,32,111,102,99,
-111,110,115,116,105,116,117,116,101,115,119,111,114,107,101,100,32,119,105,116,
-104,101,114,60,47,97,62,60,47,108,105,62,111,102,32,104,105,115,32,108,105,102,
-101,97,99,99,111,109,112,97,110,105,101,100,99,108,105,101,110,116,87,105,100,
-116,104,112,114,101,118,101,110,116,32,116,104,101,76,101,103,105,115,108,97,116
-,105,118,101,100,105,102,102,101,114,101,110,116,108,121,116,111,103,101,116,104
-,101,114,32,105,110,104,97,115,32,115,101,118,101,114,97,108,102,111,114,32,97,
-110,111,116,104,101,114,116,101,120,116,32,111,102,32,116,104,101,102,111,117,
-110,100,101,100,32,116,104,101,101,32,119,105,116,104,32,116,104,101,32,105,115,
-32,117,115,101,100,32,102,111,114,99,104,97,110,103,101,100,32,116,104,101,117,
-115,117,97,108,108,121,32,116,104,101,112,108,97,99,101,32,119,104,101,114,101,
-119,104,101,114,101,97,115,32,116,104,101,62,32,60,97,32,104,114,101,102,61,34,
-34,62,60,97,32,104,114,101,102,61,34,116,104,101,109,115,101,108,118,101,115,44,
-97,108,116,104,111,117,103,104,32,104,101,116,104,97,116,32,99,97,110,32,98,101,
-116,114,97,100,105,116,105,111,110,97,108,114,111,108,101,32,111,102,32,116,104,
-101,97,115,32,97,32,114,101,115,117,108,116,114,101,109,111,118,101,67,104,105,
-108,100,100,101,115,105,103,110,101,100,32,98,121,119,101,115,116,32,111,102,32,
-116,104,101,83,111,109,101,32,112,101,111,112,108,101,112,114,111,100,117,99,116
-,105,111,110,44,115,105,100,101,32,111,102,32,116,104,101,110,101,119,115,108,
-101,116,116,101,114,115,117,115,101,100,32,98,121,32,116,104,101,100,111,119,110
-,32,116,111,32,116,104,101,97,99,99,101,112,116,101,100,32,98,121,108,105,118,
-101,32,105,110,32,116,104,101,97,116,116,101,109,112,116,115,32,116,111,111,117,
-116,115,105,100,101,32,116,104,101,102,114,101,113,117,101,110,99,105,101,115,72
-,111,119,101,118,101,114,44,32,105,110,112,114,111,103,114,97,109,109,101,114,
-115,97,116,32,108,101,97,115,116,32,105,110,97,112,112,114,111,120,105,109,97,
-116,101,97,108,116,104,111,117,103,104,32,105,116,119,97,115,32,112,97,114,116,
-32,111,102,97,110,100,32,118,97,114,105,111,117,115,71,111,118,101,114,110,111,
-114,32,111,102,116,104,101,32,97,114,116,105,99,108,101,116,117,114,110,101,100,
-32,105,110,116,111,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,101,99,
-111,110,111,109,121,105,115,32,116,104,101,32,109,111,115,116,109,111,115,116,32
-,119,105,100,101,108,121,119,111,117,108,100,32,108,97,116,101,114,97,110,100,32
-,112,101,114,104,97,112,115,114,105,115,101,32,116,111,32,116,104,101,111,99,99,
-117,114,115,32,119,104,101,110,117,110,100,101,114,32,119,104,105,99,104,99,111,
-110,100,105,116,105,111,110,115,46,116,104,101,32,119,101,115,116,101,114,110,
-116,104,101,111,114,121,32,116,104,97,116,105,115,32,112,114,111,100,117,99,101,
-100,116,104,101,32,99,105,116,121,32,111,102,105,110,32,119,104,105,99,104,32,
-104,101,115,101,101,110,32,105,110,32,116,104,101,116,104,101,32,99,101,110,116,
-114,97,108,98,117,105,108,100,105,110,103,32,111,102,109,97,110,121,32,111,102,
-32,104,105,115,97,114,101,97,32,111,102,32,116,104,101,105,115,32,116,104,101,32
-,111,110,108,121,109,111,115,116,32,111,102,32,116,104,101,109,97,110,121,32,111
-,102,32,116,104,101,116,104,101,32,87,101,115,116,101,114,110,84,104,101,114,101
-,32,105,115,32,110,111,101,120,116,101,110,100,101,100,32,116,111,83,116,97,116,
-105,115,116,105,99,97,108,99,111,108,115,112,97,110,61,50,32,124,115,104,111,114
-,116,32,115,116,111,114,121,112,111,115,115,105,98,108,101,32,116,111,116,111,
-112,111,108,111,103,105,99,97,108,99,114,105,116,105,99,97,108,32,111,102,114,
-101,112,111,114,116,101,100,32,116,111,97,32,67,104,114,105,115,116,105,97,110,
-100,101,99,105,115,105,111,110,32,116,111,105,115,32,101,113,117,97,108,32,116,
-111,112,114,111,98,108,101,109,115,32,111,102,84,104,105,115,32,99,97,110,32,98,
-101,109,101,114,99,104,97,110,100,105,115,101,102,111,114,32,109,111,115,116,32,
-111,102,110,111,32,101,118,105,100,101,110,99,101,101,100,105,116,105,111,110,
-115,32,111,102,101,108,101,109,101,110,116,115,32,105,110,38,113,117,111,116,59,
-46,32,84,104,101,99,111,109,47,105,109,97,103,101,115,47,119,104,105,99,104,32,
-109,97,107,101,115,116,104,101,32,112,114,111,99,101,115,115,114,101,109,97,105,
-110,115,32,116,104,101,108,105,116,101,114,97,116,117,114,101,44,105,115,32,97,
-32,109,101,109,98,101,114,116,104,101,32,112,111,112,117,108,97,114,116,104,101,
-32,97,110,99,105,101,110,116,112,114,111,98,108,101,109,115,32,105,110,116,105,
-109,101,32,111,102,32,116,104,101,100,101,102,101,97,116,101,100,32,98,121,98,
-111,100,121,32,111,102,32,116,104,101,97,32,102,101,119,32,121,101,97,114,115,
-109,117,99,104,32,111,102,32,116,104,101,116,104,101,32,119,111,114,107,32,111,
-102,67,97,108,105,102,111,114,110,105,97,44,115,101,114,118,101,100,32,97,115,32
-,97,103,111,118,101,114,110,109,101,110,116,46,99,111,110,99,101,112,116,115,32,
-111,102,109,111,118,101,109,101,110,116,32,105,110,9,9,60,100,105,118,32,105,100
-,61,34,105,116,34,32,118,97,108,117,101,61,34,108,97,110,103,117,97,103,101,32,
-111,102,97,115,32,116,104,101,121,32,97,114,101,112,114,111,100,117,99,101,100,
-32,105,110,105,115,32,116,104,97,116,32,116,104,101,101,120,112,108,97,105,110,
-32,116,104,101,100,105,118,62,60,47,100,105,118,62,10,72,111,119,101,118,101,114
-,32,116,104,101,108,101,97,100,32,116,111,32,116,104,101,9,60,97,32,104,114,101,
-102,61,34,47,119,97,115,32,103,114,97,110,116,101,100,112,101,111,112,108,101,32
-,104,97,118,101,99,111,110,116,105,110,117,97,108,108,121,119,97,115,32,115,101,
-101,110,32,97,115,97,110,100,32,114,101,108,97,116,101,100,116,104,101,32,114,
-111,108,101,32,111,102,112,114,111,112,111,115,101,100,32,98,121,111,102,32,116,
-104,101,32,98,101,115,116,101,97,99,104,32,111,116,104,101,114,46,67,111,110,115
-,116,97,110,116,105,110,101,112,101,111,112,108,101,32,102,114,111,109,100,105,
-97,108,101,99,116,115,32,111,102,116,111,32,114,101,118,105,115,105,111,110,119,
-97,115,32,114,101,110,97,109,101,100,97,32,115,111,117,114,99,101,32,111,102,116
-,104,101,32,105,110,105,116,105,97,108,108,97,117,110,99,104,101,100,32,105,110,
-112,114,111,118,105,100,101,32,116,104,101,116,111,32,116,104,101,32,119,101,115
-,116,119,104,101,114,101,32,116,104,101,114,101,97,110,100,32,115,105,109,105,
-108,97,114,98,101,116,119,101,101,110,32,116,119,111,105,115,32,97,108,115,111,
-32,116,104,101,69,110,103,108,105,115,104,32,97,110,100,99,111,110,100,105,116,
-105,111,110,115,44,116,104,97,116,32,105,116,32,119,97,115,101,110,116,105,116,
-108,101,100,32,116,111,116,104,101,109,115,101,108,118,101,115,46,113,117,97,110
-,116,105,116,121,32,111,102,114,97,110,115,112,97,114,101,110,99,121,116,104,101
-,32,115,97,109,101,32,97,115,116,111,32,106,111,105,110,32,116,104,101,99,111,
-117,110,116,114,121,32,97,110,100,116,104,105,115,32,105,115,32,116,104,101,84,
-104,105,115,32,108,101,100,32,116,111,97,32,115,116,97,116,101,109,101,110,116,
-99,111,110,116,114,97,115,116,32,116,111,108,97,115,116,73,110,100,101,120,79,
-102,116,104,114,111,117,103,104,32,104,105,115,105,115,32,100,101,115,105,103,
-110,101,100,116,104,101,32,116,101,114,109,32,105,115,105,115,32,112,114,111,118
-,105,100,101,100,112,114,111,116,101,99,116,32,116,104,101,110,103,60,47,97,62,
-60,47,108,105,62,84,104,101,32,99,117,114,114,101,110,116,116,104,101,32,115,105
-,116,101,32,111,102,115,117,98,115,116,97,110,116,105,97,108,101,120,112,101,114
-,105,101,110,99,101,44,105,110,32,116,104,101,32,87,101,115,116,116,104,101,121,
-32,115,104,111,117,108,100,115,108,111,118,101,110,196,141,105,110,97,99,111,109
-,101,110,116,97,114,105,111,115,117,110,105,118,101,114,115,105,100,97,100,99,
-111,110,100,105,99,105,111,110,101,115,97,99,116,105,118,105,100,97,100,101,115,
-101,120,112,101,114,105,101,110,99,105,97,116,101,99,110,111,108,111,103,195,173
-,97,112,114,111,100,117,99,99,105,195,179,110,112,117,110,116,117,97,99,105,195,
-179,110,97,112,108,105,99,97,99,105,195,179,110,99,111,110,116,114,97,115,101,
-195,177,97,99,97,116,101,103,111,114,195,173,97,115,114,101,103,105,115,116,114,
-97,114,115,101,112,114,111,102,101,115,105,111,110,97,108,116,114,97,116,97,109,
-105,101,110,116,111,114,101,103,195,173,115,116,114,97,116,101,115,101,99,114,
-101,116,97,114,195,173,97,112,114,105,110,99,105,112,97,108,101,115,112,114,111,
-116,101,99,99,105,195,179,110,105,109,112,111,114,116,97,110,116,101,115,105,109
-,112,111,114,116,97,110,99,105,97,112,111,115,105,98,105,108,105,100,97,100,105,
-110,116,101,114,101,115,97,110,116,101,99,114,101,99,105,109,105,101,110,116,111
-,110,101,99,101,115,105,100,97,100,101,115,115,117,115,99,114,105,98,105,114,115
-,101,97,115,111,99,105,97,99,105,195,179,110,100,105,115,112,111,110,105,98,108,
-101,115,101,118,97,108,117,97,99,105,195,179,110,101,115,116,117,100,105,97,110,
-116,101,115,114,101,115,112,111,110,115,97,98,108,101,114,101,115,111,108,117,99
-,105,195,179,110,103,117,97,100,97,108,97,106,97,114,97,114,101,103,105,115,116,
-114,97,100,111,115,111,112,111,114,116,117,110,105,100,97,100,99,111,109,101,114
-,99,105,97,108,101,115,102,111,116,111,103,114,97,102,195,173,97,97,117,116,111,
-114,105,100,97,100,101,115,105,110,103,101,110,105,101,114,195,173,97,116,101,
-108,101,118,105,115,105,195,179,110,99,111,109,112,101,116,101,110,99,105,97,111
-,112,101,114,97,99,105,111,110,101,115,101,115,116,97,98,108,101,99,105,100,111,
-115,105,109,112,108,101,109,101,110,116,101,97,99,116,117,97,108,109,101,110,116
-,101,110,97,118,101,103,97,99,105,195,179,110,99,111,110,102,111,114,109,105,100
-,97,100,108,105,110,101,45,104,101,105,103,104,116,58,102,111,110,116,45,102,97,
-109,105,108,121,58,34,32,58,32,34,104,116,116,112,58,47,47,97,112,112,108,105,99
-,97,116,105,111,110,115,108,105,110,107,34,32,104,114,101,102,61,34,115,112,101,
-99,105,102,105,99,97,108,108,121,47,47,60,33,91,67,68,65,84,65,91,10,79,114,103,
-97,110,105,122,97,116,105,111,110,100,105,115,116,114,105,98,117,116,105,111,110
-,48,112,120,59,32,104,101,105,103,104,116,58,114,101,108,97,116,105,111,110,115,
-104,105,112,100,101,118,105,99,101,45,119,105,100,116,104,60,100,105,118,32,99,
-108,97,115,115,61,34,60,108,97,98,101,108,32,102,111,114,61,34,114,101,103,105,
-115,116,114,97,116,105,111,110,60,47,110,111,115,99,114,105,112,116,62,10,47,105
-,110,100,101,120,46,104,116,109,108,34,119,105,110,100,111,119,46,111,112,101,
-110,40,32,33,105,109,112,111,114,116,97,110,116,59,97,112,112,108,105,99,97,116,
-105,111,110,47,105,110,100,101,112,101,110,100,101,110,99,101,47,47,119,119,119,
-46,103,111,111,103,108,101,111,114,103,97,110,105,122,97,116,105,111,110,97,117,
-116,111,99,111,109,112,108,101,116,101,114,101,113,117,105,114,101,109,101,110,
-116,115,99,111,110,115,101,114,118,97,116,105,118,101,60,102,111,114,109,32,110,
-97,109,101,61,34,105,110,116,101,108,108,101,99,116,117,97,108,109,97,114,103,
-105,110,45,108,101,102,116,58,49,56,116,104,32,99,101,110,116,117,114,121,97,110
-,32,105,109,112,111,114,116,97,110,116,105,110,115,116,105,116,117,116,105,111,
-110,115,97,98,98,114,101,118,105,97,116,105,111,110,60,105,109,103,32,99,108,97,
-115,115,61,34,111,114,103,97,110,105,115,97,116,105,111,110,99,105,118,105,108,
-105,122,97,116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,97,114,99
-,104,105,116,101,99,116,117,114,101,105,110,99,111,114,112,111,114,97,116,101,
-100,50,48,116,104,32,99,101,110,116,117,114,121,45,99,111,110,116,97,105,110,101
-,114,34,62,109,111,115,116,32,110,111,116,97,98,108,121,47,62,60,47,97,62,60,47,
-100,105,118,62,110,111,116,105,102,105,99,97,116,105,111,110,39,117,110,100,101,
-102,105,110,101,100,39,41,70,117,114,116,104,101,114,109,111,114,101,44,98,101,
-108,105,101,118,101,32,116,104,97,116,105,110,110,101,114,72,84,77,76,32,61,32,
-112,114,105,111,114,32,116,111,32,116,104,101,100,114,97,109,97,116,105,99,97,
-108,108,121,114,101,102,101,114,114,105,110,103,32,116,111,110,101,103,111,116,
-105,97,116,105,111,110,115,104,101,97,100,113,117,97,114,116,101,114,115,83,111,
-117,116,104,32,65,102,114,105,99,97,117,110,115,117,99,99,101,115,115,102,117,
-108,80,101,110,110,115,121,108,118,97,110,105,97,65,115,32,97,32,114,101,115,117
-,108,116,44,60,104,116,109,108,32,108,97,110,103,61,34,38,108,116,59,47,115,117,
-112,38,103,116,59,100,101,97,108,105,110,103,32,119,105,116,104,112,104,105,108,
-97,100,101,108,112,104,105,97,104,105,115,116,111,114,105,99,97,108,108,121,41,
-59,60,47,115,99,114,105,112,116,62,10,112,97,100,100,105,110,103,45,116,111,112,
-58,101,120,112,101,114,105,109,101,110,116,97,108,103,101,116,65,116,116,114,105
-,98,117,116,101,105,110,115,116,114,117,99,116,105,111,110,115,116,101,99,104,
-110,111,108,111,103,105,101,115,112,97,114,116,32,111,102,32,116,104,101,32,61,
-102,117,110,99,116,105,111,110,40,41,123,115,117,98,115,99,114,105,112,116,105,
-111,110,108,46,100,116,100,34,62,13,10,60,104,116,103,101,111,103,114,97,112,104
-,105,99,97,108,67,111,110,115,116,105,116,117,116,105,111,110,39,44,32,102,117,
-110,99,116,105,111,110,40,115,117,112,112,111,114,116,101,100,32,98,121,97,103,
-114,105,99,117,108,116,117,114,97,108,99,111,110,115,116,114,117,99,116,105,111,
-110,112,117,98,108,105,99,97,116,105,111,110,115,102,111,110,116,45,115,105,122,
-101,58,32,49,97,32,118,97,114,105,101,116,121,32,111,102,60,100,105,118,32,115,
-116,121,108,101,61,34,69,110,99,121,99,108,111,112,101,100,105,97,105,102,114,97
-,109,101,32,115,114,99,61,34,100,101,109,111,110,115,116,114,97,116,101,100,97,
-99,99,111,109,112,108,105,115,104,101,100,117,110,105,118,101,114,115,105,116,
-105,101,115,68,101,109,111,103,114,97,112,104,105,99,115,41,59,60,47,115,99,114,
-105,112,116,62,60,100,101,100,105,99,97,116,101,100,32,116,111,107,110,111,119,
-108,101,100,103,101,32,111,102,115,97,116,105,115,102,97,99,116,105,111,110,112,
-97,114,116,105,99,117,108,97,114,108,121,60,47,100,105,118,62,60,47,100,105,118,
-62,69,110,103,108,105,115,104,32,40,85,83,41,97,112,112,101,110,100,67,104,105,
-108,100,40,116,114,97,110,115,109,105,115,115,105,111,110,115,46,32,72,111,119,
-101,118,101,114,44,32,105,110,116,101,108,108,105,103,101,110,99,101,34,32,116,
-97,98,105,110,100,101,120,61,34,102,108,111,97,116,58,114,105,103,104,116,59,67,
-111,109,109,111,110,119,101,97,108,116,104,114,97,110,103,105,110,103,32,102,114
-,111,109,105,110,32,119,104,105,99,104,32,116,104,101,97,116,32,108,101,97,115,
-116,32,111,110,101,114,101,112,114,111,100,117,99,116,105,111,110,101,110,99,121
-,99,108,111,112,101,100,105,97,59,102,111,110,116,45,115,105,122,101,58,49,106,
-117,114,105,115,100,105,99,116,105,111,110,97,116,32,116,104,97,116,32,116,105,
-109,101,34,62,60,97,32,99,108,97,115,115,61,34,73,110,32,97,100,100,105,116,105,
-111,110,44,100,101,115,99,114,105,112,116,105,111,110,43,99,111,110,118,101,114,
-115,97,116,105,111,110,99,111,110,116,97,99,116,32,119,105,116,104,105,115,32,
-103,101,110,101,114,97,108,108,121,114,34,32,99,111,110,116,101,110,116,61,34,
-114,101,112,114,101,115,101,110,116,105,110,103,38,108,116,59,109,97,116,104,38,
-103,116,59,112,114,101,115,101,110,116,97,116,105,111,110,111,99,99,97,115,105,
-111,110,97,108,108,121,60,105,109,103,32,119,105,100,116,104,61,34,110,97,118,
-105,103,97,116,105,111,110,34,62,99,111,109,112,101,110,115,97,116,105,111,110,
-99,104,97,109,112,105,111,110,115,104,105,112,109,101,100,105,97,61,34,97,108,
-108,34,32,118,105,111,108,97,116,105,111,110,32,111,102,114,101,102,101,114,101,
-110,99,101,32,116,111,114,101,116,117,114,110,32,116,114,117,101,59,83,116,114,
-105,99,116,47,47,69,78,34,32,116,114,97,110,115,97,99,116,105,111,110,115,105,
-110,116,101,114,118,101,110,116,105,111,110,118,101,114,105,102,105,99,97,116,
-105,111,110,73,110,102,111,114,109,97,116,105,111,110,32,100,105,102,102,105,99,
-117,108,116,105,101,115,67,104,97,109,112,105,111,110,115,104,105,112,99,97,112,
-97,98,105,108,105,116,105,101,115,60,33,91,101,110,100,105,102,93,45,45,62,125,
-10,60,47,115,99,114,105,112,116,62,10,67,104,114,105,115,116,105,97,110,105,116,
-121,102,111,114,32,101,120,97,109,112,108,101,44,80,114,111,102,101,115,115,105,
-111,110,97,108,114,101,115,116,114,105,99,116,105,111,110,115,115,117,103,103,
-101,115,116,32,116,104,97,116,119,97,115,32,114,101,108,101,97,115,101,100,40,
-115,117,99,104,32,97,115,32,116,104,101,114,101,109,111,118,101,67,108,97,115,
-115,40,117,110,101,109,112,108,111,121,109,101,110,116,116,104,101,32,65,109,101
-,114,105,99,97,110,115,116,114,117,99,116,117,114,101,32,111,102,47,105,110,100,
-101,120,46,104,116,109,108,32,112,117,98,108,105,115,104,101,100,32,105,110,115,
-112,97,110,32,99,108,97,115,115,61,34,34,62,60,97,32,104,114,101,102,61,34,47,
-105,110,116,114,111,100,117,99,116,105,111,110,98,101,108,111,110,103,105,110,
-103,32,116,111,99,108,97,105,109,101,100,32,116,104,97,116,99,111,110,115,101,
-113,117,101,110,99,101,115,60,109,101,116,97,32,110,97,109,101,61,34,71,117,105,
-100,101,32,116,111,32,116,104,101,111,118,101,114,119,104,101,108,109,105,110,
-103,97,103,97,105,110,115,116,32,116,104,101,32,99,111,110,99,101,110,116,114,97
-,116,101,100,44,10,46,110,111,110,116,111,117,99,104,32,111,98,115,101,114,118,
-97,116,105,111,110,115,60,47,97,62,10,60,47,100,105,118,62,10,102,32,40,100,111,
-99,117,109,101,110,116,46,98,111,114,100,101,114,58,32,49,112,120,32,123,102,111
-,110,116,45,115,105,122,101,58,49,116,114,101,97,116,109,101,110,116,32,111,102,
-48,34,32,104,101,105,103,104,116,61,34,49,109,111,100,105,102,105,99,97,116,105,
-111,110,73,110,100,101,112,101,110,100,101,110,99,101,100,105,118,105,100,101,
-100,32,105,110,116,111,103,114,101,97,116,101,114,32,116,104,97,110,97,99,104,
-105,101,118,101,109,101,110,116,115,101,115,116,97,98,108,105,115,104,105,110,
-103,74,97,118,97,83,99,114,105,112,116,34,32,110,101,118,101,114,116,104,101,108
-,101,115,115,115,105,103,110,105,102,105,99,97,110,99,101,66,114,111,97,100,99,
-97,115,116,105,110,103,62,38,110,98,115,112,59,60,47,116,100,62,99,111,110,116,
-97,105,110,101,114,34,62,10,115,117,99,104,32,97,115,32,116,104,101,32,105,110,
-102,108,117,101,110,99,101,32,111,102,97,32,112,97,114,116,105,99,117,108,97,114
-,115,114,99,61,39,104,116,116,112,58,47,47,110,97,118,105,103,97,116,105,111,110
-,34,32,104,97,108,102,32,111,102,32,116,104,101,32,115,117,98,115,116,97,110,116
-,105,97,108,32,38,110,98,115,112,59,60,47,100,105,118,62,97,100,118,97,110,116,
-97,103,101,32,111,102,100,105,115,99,111,118,101,114,121,32,111,102,102,117,110,
-100,97,109,101,110,116,97,108,32,109,101,116,114,111,112,111,108,105,116,97,110,
-116,104,101,32,111,112,112,111,115,105,116,101,34,32,120,109,108,58,108,97,110,
-103,61,34,100,101,108,105,98,101,114,97,116,101,108,121,97,108,105,103,110,61,99
-,101,110,116,101,114,101,118,111,108,117,116,105,111,110,32,111,102,112,114,101,
-115,101,114,118,97,116,105,111,110,105,109,112,114,111,118,101,109,101,110,116,
-115,98,101,103,105,110,110,105,110,103,32,105,110,74,101,115,117,115,32,67,104,
-114,105,115,116,80,117,98,108,105,99,97,116,105,111,110,115,100,105,115,97,103,
-114,101,101,109,101,110,116,116,101,120,116,45,97,108,105,103,110,58,114,44,32,
-102,117,110,99,116,105,111,110,40,41,115,105,109,105,108,97,114,105,116,105,101,
-115,98,111,100,121,62,60,47,104,116,109,108,62,105,115,32,99,117,114,114,101,110
-,116,108,121,97,108,112,104,97,98,101,116,105,99,97,108,105,115,32,115,111,109,
-101,116,105,109,101,115,116,121,112,101,61,34,105,109,97,103,101,47,109,97,110,
-121,32,111,102,32,116,104,101,32,102,108,111,119,58,104,105,100,100,101,110,59,
-97,118,97,105,108,97,98,108,101,32,105,110,100,101,115,99,114,105,98,101,32,116,
-104,101,101,120,105,115,116,101,110,99,101,32,111,102,97,108,108,32,111,118,101,
-114,32,116,104,101,116,104,101,32,73,110,116,101,114,110,101,116,9,60,117,108,32
-,99,108,97,115,115,61,34,105,110,115,116,97,108,108,97,116,105,111,110,110,101,
-105,103,104,98,111,114,104,111,111,100,97,114,109,101,100,32,102,111,114,99,101,
-115,114,101,100,117,99,105,110,103,32,116,104,101,99,111,110,116,105,110,117,101
-,115,32,116,111,78,111,110,101,116,104,101,108,101,115,115,44,116,101,109,112,
-101,114,97,116,117,114,101,115,10,9,9,60,97,32,104,114,101,102,61,34,99,108,111,
-115,101,32,116,111,32,116,104,101,101,120,97,109,112,108,101,115,32,111,102,32,
-105,115,32,97,98,111,117,116,32,116,104,101,40,115,101,101,32,98,101,108,111,119
-,41,46,34,32,105,100,61,34,115,101,97,114,99,104,112,114,111,102,101,115,115,105
-,111,110,97,108,105,115,32,97,118,97,105,108,97,98,108,101,116,104,101,32,111,
-102,102,105,99,105,97,108,9,9,60,47,115,99,114,105,112,116,62,10,10,9,9,60,100,
-105,118,32,105,100,61,34,97,99,99,101,108,101,114,97,116,105,111,110,116,104,114
-,111,117,103,104,32,116,104,101,32,72,97,108,108,32,111,102,32,70,97,109,101,100
-,101,115,99,114,105,112,116,105,111,110,115,116,114,97,110,115,108,97,116,105,
-111,110,115,105,110,116,101,114,102,101,114,101,110,99,101,32,116,121,112,101,61
-,39,116,101,120,116,47,114,101,99,101,110,116,32,121,101,97,114,115,105,110,32,
-116,104,101,32,119,111,114,108,100,118,101,114,121,32,112,111,112,117,108,97,114
-,123,98,97,99,107,103,114,111,117,110,100,58,116,114,97,100,105,116,105,111,110,
-97,108,32,115,111,109,101,32,111,102,32,116,104,101,32,99,111,110,110,101,99,116
-,101,100,32,116,111,101,120,112,108,111,105,116,97,116,105,111,110,101,109,101,
-114,103,101,110,99,101,32,111,102,99,111,110,115,116,105,116,117,116,105,111,110
-,65,32,72,105,115,116,111,114,121,32,111,102,115,105,103,110,105,102,105,99,97,
-110,116,32,109,97,110,117,102,97,99,116,117,114,101,100,101,120,112,101,99,116,
-97,116,105,111,110,115,62,60,110,111,115,99,114,105,112,116,62,60,99,97,110,32,
-98,101,32,102,111,117,110,100,98,101,99,97,117,115,101,32,116,104,101,32,104,97,
-115,32,110,111,116,32,98,101,101,110,110,101,105,103,104,98,111,117,114,105,110,
-103,119,105,116,104,111,117,116,32,116,104,101,32,97,100,100,101,100,32,116,111,
-32,116,104,101,9,60,108,105,32,99,108,97,115,115,61,34,105,110,115,116,114,117,
-109,101,110,116,97,108,83,111,118,105,101,116,32,85,110,105,111,110,97,99,107,
-110,111,119,108,101,100,103,101,100,119,104,105,99,104,32,99,97,110,32,98,101,
-110,97,109,101,32,102,111,114,32,116,104,101,97,116,116,101,110,116,105,111,110,
-32,116,111,97,116,116,101,109,112,116,115,32,116,111,32,100,101,118,101,108,111,
-112,109,101,110,116,115,73,110,32,102,97,99,116,44,32,116,104,101,60,108,105,32,
-99,108,97,115,115,61,34,97,105,109,112,108,105,99,97,116,105,111,110,115,115,117
-,105,116,97,98,108,101,32,102,111,114,109,117,99,104,32,111,102,32,116,104,101,
-32,99,111,108,111,110,105,122,97,116,105,111,110,112,114,101,115,105,100,101,110
-,116,105,97,108,99,97,110,99,101,108,66,117,98,98,108,101,32,73,110,102,111,114,
-109,97,116,105,111,110,109,111,115,116,32,111,102,32,116,104,101,32,105,115,32,
-100,101,115,99,114,105,98,101,100,114,101,115,116,32,111,102,32,116,104,101,32,
-109,111,114,101,32,111,114,32,108,101,115,115,105,110,32,83,101,112,116,101,109,
-98,101,114,73,110,116,101,108,108,105,103,101,110,99,101,115,114,99,61,34,104,
-116,116,112,58,47,47,112,120,59,32,104,101,105,103,104,116,58,32,97,118,97,105,
-108,97,98,108,101,32,116,111,109,97,110,117,102,97,99,116,117,114,101,114,104,
-117,109,97,110,32,114,105,103,104,116,115,108,105,110,107,32,104,114,101,102,61,
-34,47,97,118,97,105,108,97,98,105,108,105,116,121,112,114,111,112,111,114,116,
-105,111,110,97,108,111,117,116,115,105,100,101,32,116,104,101,32,97,115,116,114,
-111,110,111,109,105,99,97,108,104,117,109,97,110,32,98,101,105,110,103,115,110,
-97,109,101,32,111,102,32,116,104,101,32,97,114,101,32,102,111,117,110,100,32,105
-,110,97,114,101,32,98,97,115,101,100,32,111,110,115,109,97,108,108,101,114,32,
-116,104,97,110,97,32,112,101,114,115,111,110,32,119,104,111,101,120,112,97,110,
-115,105,111,110,32,111,102,97,114,103,117,105,110,103,32,116,104,97,116,110,111,
-119,32,107,110,111,119,110,32,97,115,73,110,32,116,104,101,32,101,97,114,108,121
-,105,110,116,101,114,109,101,100,105,97,116,101,100,101,114,105,118,101,100,32,
-102,114,111,109,83,99,97,110,100,105,110,97,118,105,97,110,60,47,97,62,60,47,100
-,105,118,62,13,10,99,111,110,115,105,100,101,114,32,116,104,101,97,110,32,101,
-115,116,105,109,97,116,101,100,116,104,101,32,78,97,116,105,111,110,97,108,60,
-100,105,118,32,105,100,61,34,112,97,103,114,101,115,117,108,116,105,110,103,32,
-105,110,99,111,109,109,105,115,115,105,111,110,101,100,97,110,97,108,111,103,111
-,117,115,32,116,111,97,114,101,32,114,101,113,117,105,114,101,100,47,117,108,62,
-10,60,47,100,105,118,62,10,119,97,115,32,98,97,115,101,100,32,111,110,97,110,100
-,32,98,101,99,97,109,101,32,97,38,110,98,115,112,59,38,110,98,115,112,59,116,34,
-32,118,97,108,117,101,61,34,34,32,119,97,115,32,99,97,112,116,117,114,101,100,
-110,111,32,109,111,114,101,32,116,104,97,110,114,101,115,112,101,99,116,105,118,
-101,108,121,99,111,110,116,105,110,117,101,32,116,111,32,62,13,10,60,104,101,97,
-100,62,13,10,60,119,101,114,101,32,99,114,101,97,116,101,100,109,111,114,101,32,
-103,101,110,101,114,97,108,105,110,102,111,114,109,97,116,105,111,110,32,117,115
-,101,100,32,102,111,114,32,116,104,101,105,110,100,101,112,101,110,100,101,110,
-116,32,116,104,101,32,73,109,112,101,114,105,97,108,99,111,109,112,111,110,101,
-110,116,32,111,102,116,111,32,116,104,101,32,110,111,114,116,104,105,110,99,108,
-117,100,101,32,116,104,101,32,67,111,110,115,116,114,117,99,116,105,111,110,115,
-105,100,101,32,111,102,32,116,104,101,32,119,111,117,108,100,32,110,111,116,32,
-98,101,102,111,114,32,105,110,115,116,97,110,99,101,105,110,118,101,110,116,105,
-111,110,32,111,102,109,111,114,101,32,99,111,109,112,108,101,120,99,111,108,108,
-101,99,116,105,118,101,108,121,98,97,99,107,103,114,111,117,110,100,58,32,116,
-101,120,116,45,97,108,105,103,110,58,32,105,116,115,32,111,114,105,103,105,110,
-97,108,105,110,116,111,32,97,99,99,111,117,110,116,116,104,105,115,32,112,114,
-111,99,101,115,115,97,110,32,101,120,116,101,110,115,105,118,101,104,111,119,101
-,118,101,114,44,32,116,104,101,116,104,101,121,32,97,114,101,32,110,111,116,114,
-101,106,101,99,116,101,100,32,116,104,101,99,114,105,116,105,99,105,115,109,32,
-111,102,100,117,114,105,110,103,32,119,104,105,99,104,112,114,111,98,97,98,108,
-121,32,116,104,101,116,104,105,115,32,97,114,116,105,99,108,101,40,102,117,110,
-99,116,105,111,110,40,41,123,73,116,32,115,104,111,117,108,100,32,98,101,97,110,
-32,97,103,114,101,101,109,101,110,116,97,99,99,105,100,101,110,116,97,108,108,
-121,100,105,102,102,101,114,115,32,102,114,111,109,65,114,99,104,105,116,101,99,
-116,117,114,101,98,101,116,116,101,114,32,107,110,111,119,110,97,114,114,97,110,
-103,101,109,101,110,116,115,105,110,102,108,117,101,110,99,101,32,111,110,97,116
-,116,101,110,100,101,100,32,116,104,101,105,100,101,110,116,105,99,97,108,32,116
-,111,115,111,117,116,104,32,111,102,32,116,104,101,112,97,115,115,32,116,104,114
-,111,117,103,104,120,109,108,34,32,116,105,116,108,101,61,34,119,101,105,103,104
-,116,58,98,111,108,100,59,99,114,101,97,116,105,110,103,32,116,104,101,100,105,
-115,112,108,97,121,58,110,111,110,101,114,101,112,108,97,99,101,100,32,116,104,
-101,60,105,109,103,32,115,114,99,61,34,47,105,104,116,116,112,115,58,47,47,119,
-119,119,46,87,111,114,108,100,32,87,97,114,32,73,73,116,101,115,116,105,109,111,
-110,105,97,108,115,102,111,117,110,100,32,105,110,32,116,104,101,114,101,113,117
-,105,114,101,100,32,116,111,32,97,110,100,32,116,104,97,116,32,116,104,101,98,
-101,116,119,101,101,110,32,116,104,101,32,119,97,115,32,100,101,115,105,103,110,
-101,100,99,111,110,115,105,115,116,115,32,111,102,32,99,111,110,115,105,100,101,
-114,97,98,108,121,112,117,98,108,105,115,104,101,100,32,98,121,116,104,101,32,
-108,97,110,103,117,97,103,101,67,111,110,115,101,114,118,97,116,105,111,110,99,
-111,110,115,105,115,116,101,100,32,111,102,114,101,102,101,114,32,116,111,32,116
-,104,101,98,97,99,107,32,116,111,32,116,104,101,32,99,115,115,34,32,109,101,100,
-105,97,61,34,80,101,111,112,108,101,32,102,114,111,109,32,97,118,97,105,108,97,
-98,108,101,32,111,110,112,114,111,118,101,100,32,116,111,32,98,101,115,117,103,
-103,101,115,116,105,111,110,115,34,119,97,115,32,107,110,111,119,110,32,97,115,
-118,97,114,105,101,116,105,101,115,32,111,102,108,105,107,101,108,121,32,116,111
-,32,98,101,99,111,109,112,114,105,115,101,100,32,111,102,115,117,112,112,111,114
-,116,32,116,104,101,32,104,97,110,100,115,32,111,102,32,116,104,101,99,111,117,
-112,108,101,100,32,119,105,116,104,99,111,110,110,101,99,116,32,97,110,100,32,98
-,111,114,100,101,114,58,110,111,110,101,59,112,101,114,102,111,114,109,97,110,99
-,101,115,98,101,102,111,114,101,32,98,101,105,110,103,108,97,116,101,114,32,98,
-101,99,97,109,101,99,97,108,99,117,108,97,116,105,111,110,115,111,102,116,101,
-110,32,99,97,108,108,101,100,114,101,115,105,100,101,110,116,115,32,111,102,109,
-101,97,110,105,110,103,32,116,104,97,116,62,60,108,105,32,99,108,97,115,115,61,
-34,101,118,105,100,101,110,99,101,32,102,111,114,101,120,112,108,97,110,97,116,
-105,111,110,115,101,110,118,105,114,111,110,109,101,110,116,115,34,62,60,47,97,
-62,60,47,100,105,118,62,119,104,105,99,104,32,97,108,108,111,119,115,73,110,116,
-114,111,100,117,99,116,105,111,110,100,101,118,101,108,111,112,101,100,32,98,121
-,97,32,119,105,100,101,32,114,97,110,103,101,111,110,32,98,101,104,97,108,102,32
-,111,102,118,97,108,105,103,110,61,34,116,111,112,34,112,114,105,110,99,105,112,
-108,101,32,111,102,97,116,32,116,104,101,32,116,105,109,101,44,60,47,110,111,115
-,99,114,105,112,116,62,13,115,97,105,100,32,116,111,32,104,97,118,101,105,110,32
-,116,104,101,32,102,105,114,115,116,119,104,105,108,101,32,111,116,104,101,114,
-115,104,121,112,111,116,104,101,116,105,99,97,108,112,104,105,108,111,115,111,
-112,104,101,114,115,112,111,119,101,114,32,111,102,32,116,104,101,99,111,110,116
-,97,105,110,101,100,32,105,110,112,101,114,102,111,114,109,101,100,32,98,121,105
-,110,97,98,105,108,105,116,121,32,116,111,119,101,114,101,32,119,114,105,116,116
-,101,110,115,112,97,110,32,115,116,121,108,101,61,34,105,110,112,117,116,32,110,
-97,109,101,61,34,116,104,101,32,113,117,101,115,116,105,111,110,105,110,116,101,
-110,100,101,100,32,102,111,114,114,101,106,101,99,116,105,111,110,32,111,102,105
-,109,112,108,105,101,115,32,116,104,97,116,105,110,118,101,110,116,101,100,32,
-116,104,101,116,104,101,32,115,116,97,110,100,97,114,100,119,97,115,32,112,114,
-111,98,97,98,108,121,108,105,110,107,32,98,101,116,119,101,101,110,112,114,111,
-102,101,115,115,111,114,32,111,102,105,110,116,101,114,97,99,116,105,111,110,115
-,99,104,97,110,103,105,110,103,32,116,104,101,73,110,100,105,97,110,32,79,99,101
-,97,110,32,99,108,97,115,115,61,34,108,97,115,116,119,111,114,107,105,110,103,32
-,119,105,116,104,39,104,116,116,112,58,47,47,119,119,119,46,121,101,97,114,115,
-32,98,101,102,111,114,101,84,104,105,115,32,119,97,115,32,116,104,101,114,101,99
-,114,101,97,116,105,111,110,97,108,101,110,116,101,114,105,110,103,32,116,104,
-101,109,101,97,115,117,114,101,109,101,110,116,115,97,110,32,101,120,116,114,101
-,109,101,108,121,118,97,108,117,101,32,111,102,32,116,104,101,115,116,97,114,116
-,32,111,102,32,116,104,101,10,60,47,115,99,114,105,112,116,62,10,10,97,110,32,
-101,102,102,111,114,116,32,116,111,105,110,99,114,101,97,115,101,32,116,104,101,
-116,111,32,116,104,101,32,115,111,117,116,104,115,112,97,99,105,110,103,61,34,48
-,34,62,115,117,102,102,105,99,105,101,110,116,108,121,116,104,101,32,69,117,114,
-111,112,101,97,110,99,111,110,118,101,114,116,101,100,32,116,111,99,108,101,97,
-114,84,105,109,101,111,117,116,100,105,100,32,110,111,116,32,104,97,118,101,99,
-111,110,115,101,113,117,101,110,116,108,121,102,111,114,32,116,104,101,32,110,
-101,120,116,101,120,116,101,110,115,105,111,110,32,111,102,101,99,111,110,111,
-109,105,99,32,97,110,100,97,108,116,104,111,117,103,104,32,116,104,101,97,114,
-101,32,112,114,111,100,117,99,101,100,97,110,100,32,119,105,116,104,32,116,104,
-101,105,110,115,117,102,102,105,99,105,101,110,116,103,105,118,101,110,32,98,121
-,32,116,104,101,115,116,97,116,105,110,103,32,116,104,97,116,101,120,112,101,110
-,100,105,116,117,114,101,115,60,47,115,112,97,110,62,60,47,97,62,10,116,104,111,
-117,103,104,116,32,116,104,97,116,111,110,32,116,104,101,32,98,97,115,105,115,99
-,101,108,108,112,97,100,100,105,110,103,61,105,109,97,103,101,32,111,102,32,116,
-104,101,114,101,116,117,114,110,105,110,103,32,116,111,105,110,102,111,114,109,
-97,116,105,111,110,44,115,101,112,97,114,97,116,101,100,32,98,121,97,115,115,97,
-115,115,105,110,97,116,101,100,115,34,32,99,111,110,116,101,110,116,61,34,97,117
-,116,104,111,114,105,116,121,32,111,102,110,111,114,116,104,119,101,115,116,101,
-114,110,60,47,100,105,118,62,10,60,100,105,118,32,34,62,60,47,100,105,118,62,13,
-10,32,32,99,111,110,115,117,108,116,97,116,105,111,110,99,111,109,109,117,110,
-105,116,121,32,111,102,116,104,101,32,110,97,116,105,111,110,97,108,105,116,32,
-115,104,111,117,108,100,32,98,101,112,97,114,116,105,99,105,112,97,110,116,115,
-32,97,108,105,103,110,61,34,108,101,102,116,116,104,101,32,103,114,101,97,116,
-101,115,116,115,101,108,101,99,116,105,111,110,32,111,102,115,117,112,101,114,
-110,97,116,117,114,97,108,100,101,112,101,110,100,101,110,116,32,111,110,105,115
-,32,109,101,110,116,105,111,110,101,100,97,108,108,111,119,105,110,103,32,116,
-104,101,119,97,115,32,105,110,118,101,110,116,101,100,97,99,99,111,109,112,97,
-110,121,105,110,103,104,105,115,32,112,101,114,115,111,110,97,108,97,118,97,105,
-108,97,98,108,101,32,97,116,115,116,117,100,121,32,111,102,32,116,104,101,111,
-110,32,116,104,101,32,111,116,104,101,114,101,120,101,99,117,116,105,111,110,32,
-111,102,72,117,109,97,110,32,82,105,103,104,116,115,116,101,114,109,115,32,111,
-102,32,116,104,101,97,115,115,111,99,105,97,116,105,111,110,115,114,101,115,101,
-97,114,99,104,32,97,110,100,115,117,99,99,101,101,100,101,100,32,98,121,100,101,
-102,101,97,116,101,100,32,116,104,101,97,110,100,32,102,114,111,109,32,116,104,
-101,98,117,116,32,116,104,101,121,32,97,114,101,99,111,109,109,97,110,100,101,
-114,32,111,102,115,116,97,116,101,32,111,102,32,116,104,101,121,101,97,114,115,
-32,111,102,32,97,103,101,116,104,101,32,115,116,117,100,121,32,111,102,60,117,
-108,32,99,108,97,115,115,61,34,115,112,108,97,99,101,32,105,110,32,116,104,101,
-119,104,101,114,101,32,104,101,32,119,97,115,60,108,105,32,99,108,97,115,115,61,
-34,102,116,104,101,114,101,32,97,114,101,32,110,111,119,104,105,99,104,32,98,101
-,99,97,109,101,104,101,32,112,117,98,108,105,115,104,101,100,101,120,112,114,101
-,115,115,101,100,32,105,110,116,111,32,119,104,105,99,104,32,116,104,101,99,111,
-109,109,105,115,115,105,111,110,101,114,102,111,110,116,45,119,101,105,103,104,
-116,58,116,101,114,114,105,116,111,114,121,32,111,102,101,120,116,101,110,115,
-105,111,110,115,34,62,82,111,109,97,110,32,69,109,112,105,114,101,101,113,117,97
-,108,32,116,111,32,116,104,101,73,110,32,99,111,110,116,114,97,115,116,44,104,
-111,119,101,118,101,114,44,32,97,110,100,105,115,32,116,121,112,105,99,97,108,
-108,121,97,110,100,32,104,105,115,32,119,105,102,101,40,97,108,115,111,32,99,97,
-108,108,101,100,62,60,117,108,32,99,108,97,115,115,61,34,101,102,102,101,99,116,
-105,118,101,108,121,32,101,118,111,108,118,101,100,32,105,110,116,111,115,101,
-101,109,32,116,111,32,104,97,118,101,119,104,105,99,104,32,105,115,32,116,104,
-101,116,104,101,114,101,32,119,97,115,32,110,111,97,110,32,101,120,99,101,108,
-108,101,110,116,97,108,108,32,111,102,32,116,104,101,115,101,100,101,115,99,114,
-105,98,101,100,32,98,121,73,110,32,112,114,97,99,116,105,99,101,44,98,114,111,97
-,100,99,97,115,116,105,110,103,99,104,97,114,103,101,100,32,119,105,116,104,114,
-101,102,108,101,99,116,101,100,32,105,110,115,117,98,106,101,99,116,101,100,32,
-116,111,109,105,108,105,116,97,114,121,32,97,110,100,116,111,32,116,104,101,32,
-112,111,105,110,116,101,99,111,110,111,109,105,99,97,108,108,121,115,101,116,84,
-97,114,103,101,116,105,110,103,97,114,101,32,97,99,116,117,97,108,108,121,118,
-105,99,116,111,114,121,32,111,118,101,114,40,41,59,60,47,115,99,114,105,112,116,
-62,99,111,110,116,105,110,117,111,117,115,108,121,114,101,113,117,105,114,101,
-100,32,102,111,114,101,118,111,108,117,116,105,111,110,97,114,121,97,110,32,101,
-102,102,101,99,116,105,118,101,110,111,114,116,104,32,111,102,32,116,104,101,44,
-32,119,104,105,99,104,32,119,97,115,32,102,114,111,110,116,32,111,102,32,116,104
-,101,111,114,32,111,116,104,101,114,119,105,115,101,115,111,109,101,32,102,111,
-114,109,32,111,102,104,97,100,32,110,111,116,32,98,101,101,110,103,101,110,101,
-114,97,116,101,100,32,98,121,105,110,102,111,114,109,97,116,105,111,110,46,112,
-101,114,109,105,116,116,101,100,32,116,111,105,110,99,108,117,100,101,115,32,116
-,104,101,100,101,118,101,108,111,112,109,101,110,116,44,101,110,116,101,114,101,
-100,32,105,110,116,111,116,104,101,32,112,114,101,118,105,111,117,115,99,111,110
-,115,105,115,116,101,110,116,108,121,97,114,101,32,107,110,111,119,110,32,97,115
-,116,104,101,32,102,105,101,108,100,32,111,102,116,104,105,115,32,116,121,112,
-101,32,111,102,103,105,118,101,110,32,116,111,32,116,104,101,116,104,101,32,116,
-105,116,108,101,32,111,102,99,111,110,116,97,105,110,115,32,116,104,101,105,110,
-115,116,97,110,99,101,115,32,111,102,105,110,32,116,104,101,32,110,111,114,116,
-104,100,117,101,32,116,111,32,116,104,101,105,114,97,114,101,32,100,101,115,105,
-103,110,101,100,99,111,114,112,111,114,97,116,105,111,110,115,119,97,115,32,116,
-104,97,116,32,116,104,101,111,110,101,32,111,102,32,116,104,101,115,101,109,111,
-114,101,32,112,111,112,117,108,97,114,115,117,99,99,101,101,100,101,100,32,105,
-110,115,117,112,112,111,114,116,32,102,114,111,109,105,110,32,100,105,102,102,
-101,114,101,110,116,100,111,109,105,110,97,116,101,100,32,98,121,100,101,115,105
-,103,110,101,100,32,102,111,114,111,119,110,101,114,115,104,105,112,32,111,102,
-97,110,100,32,112,111,115,115,105,98,108,121,115,116,97,110,100,97,114,100,105,
-122,101,100,114,101,115,112,111,110,115,101,84,101,120,116,119,97,115,32,105,110
-,116,101,110,100,101,100,114,101,99,101,105,118,101,100,32,116,104,101,97,115,
-115,117,109,101,100,32,116,104,97,116,97,114,101,97,115,32,111,102,32,116,104,
-101,112,114,105,109,97,114,105,108,121,32,105,110,116,104,101,32,98,97,115,105,
-115,32,111,102,105,110,32,116,104,101,32,115,101,110,115,101,97,99,99,111,117,
-110,116,115,32,102,111,114,100,101,115,116,114,111,121,101,100,32,98,121,97,116,
-32,108,101,97,115,116,32,116,119,111,119,97,115,32,100,101,99,108,97,114,101,100
-,99,111,117,108,100,32,110,111,116,32,98,101,83,101,99,114,101,116,97,114,121,32
-,111,102,97,112,112,101,97,114,32,116,111,32,98,101,109,97,114,103,105,110,45,
-116,111,112,58,49,47,94,92,115,43,124,92,115,43,36,47,103,101,41,123,116,104,114
-,111,119,32,101,125,59,116,104,101,32,115,116,97,114,116,32,111,102,116,119,111,
-32,115,101,112,97,114,97,116,101,108,97,110,103,117,97,103,101,32,97,110,100,119
-,104,111,32,104,97,100,32,98,101,101,110,111,112,101,114,97,116,105,111,110,32,
-111,102,100,101,97,116,104,32,111,102,32,116,104,101,114,101,97,108,32,110,117,
-109,98,101,114,115,9,60,108,105,110,107,32,114,101,108,61,34,112,114,111,118,105
-,100,101,100,32,116,104,101,116,104,101,32,115,116,111,114,121,32,111,102,99,111
-,109,112,101,116,105,116,105,111,110,115,101,110,103,108,105,115,104,32,40,85,75
-,41,101,110,103,108,105,115,104,32,40,85,83,41,208,156,208,190,208,189,208,179,
-208,190,208,187,208,161,209,128,208,191,209,129,208,186,208,184,209,129,209,128,
-208,191,209,129,208,186,208,184,209,129,209,128,208,191,209,129,208,186,208,190,
-217,132,216,185,216,177,216,168,217,138,216,169,230,173,163,233,171,148,228,184,
-173,230,150,135,231,174,128,228,189,147,228,184,173,230,150,135,231,185,129,228,
-189,147,228,184,173,230,150,135,230,156,137,233,153,144,229,133,172,229,143,184,
-228,186,186,230,176,145,230,148,191,229,186,156,233,152,191,233,135,140,229,183,
-180,229,183,180,231,164,190,228,188,154,228,184,187,228,185,137,230,147,141,228,
-189,156,231,179,187,231,187,159,230,148,191,231,173,150,230,179,149,232,167,132,
-105,110,102,111,114,109,97,99,105,195,179,110,104,101,114,114,97,109,105,101,110
-,116,97,115,101,108,101,99,116,114,195,179,110,105,99,111,100,101,115,99,114,105
-,112,99,105,195,179,110,99,108,97,115,105,102,105,99,97,100,111,115,99,111,110,
-111,99,105,109,105,101,110,116,111,112,117,98,108,105,99,97,99,105,195,179,110,
-114,101,108,97,99,105,111,110,97,100,97,115,105,110,102,111,114,109,195,161,116,
-105,99,97,114,101,108,97,99,105,111,110,97,100,111,115,100,101,112,97,114,116,97
-,109,101,110,116,111,116,114,97,98,97,106,97,100,111,114,101,115,100,105,114,101
-,99,116,97,109,101,110,116,101,97,121,117,110,116,97,109,105,101,110,116,111,109
-,101,114,99,97,100,111,76,105,98,114,101,99,111,110,116,195,161,99,116,101,110,
-111,115,104,97,98,105,116,97,99,105,111,110,101,115,99,117,109,112,108,105,109,
-105,101,110,116,111,114,101,115,116,97,117,114,97,110,116,101,115,100,105,115,
-112,111,115,105,99,105,195,179,110,99,111,110,115,101,99,117,101,110,99,105,97,
-101,108,101,99,116,114,195,179,110,105,99,97,97,112,108,105,99,97,99,105,111,110
-,101,115,100,101,115,99,111,110,101,99,116,97,100,111,105,110,115,116,97,108,97,
-99,105,195,179,110,114,101,97,108,105,122,97,99,105,195,179,110,117,116,105,108,
-105,122,97,99,105,195,179,110,101,110,99,105,99,108,111,112,101,100,105,97,101,
-110,102,101,114,109,101,100,97,100,101,115,105,110,115,116,114,117,109,101,110,
-116,111,115,101,120,112,101,114,105,101,110,99,105,97,115,105,110,115,116,105,
-116,117,99,105,195,179,110,112,97,114,116,105,99,117,108,97,114,101,115,115,117,
-98,99,97,116,101,103,111,114,105,97,209,130,208,190,208,187,209,140,208,186,208,
-190,208,160,208,190,209,129,209,129,208,184,208,184,209,128,208,176,208,177,208,
-190,209,130,209,139,208,177,208,190,208,187,209,140,209,136,208,181,208,191,209,
-128,208,190,209,129,209,130,208,190,208,188,208,190,208,182,208,181,209,130,208,
-181,208,180,209,128,209,131,208,179,208,184,209,133,209,129,208,187,209,131,209,
-135,208,176,208,181,209,129,208,181,208,185,209,135,208,176,209,129,208,178,209,
-129,208,181,208,179,208,180,208,176,208,160,208,190,209,129,209,129,208,184,209,
-143,208,156,208,190,209,129,208,186,208,178,208,181,208,180,209,128,209,131,208,
-179,208,184,208,181,208,179,208,190,209,128,208,190,208,180,208,176,208,178,208,
-190,208,191,209,128,208,190,209,129,208,180,208,176,208,189,208,189,209,139,209,
-133,208,180,208,190,208,187,208,182,208,189,209,139,208,184,208,188,208,181,208,
-189,208,189,208,190,208,156,208,190,209,129,208,186,208,178,209,139,209,128,209,
-131,208,177,208,187,208,181,208,185,208,156,208,190,209,129,208,186,208,178,208,
-176,209,129,209,130,209,128,208,176,208,189,209,139,208,189,208,184,209,135,208,
-181,208,179,208,190,209,128,208,176,208,177,208,190,209,130,208,181,208,180,208,
-190,208,187,208,182,208,181,208,189,209,131,209,129,208,187,209,131,208,179,208,
-184,209,130,208,181,208,191,208,181,209,128,209,140,208,158,208,180,208,189,208,
-176,208,186,208,190,208,191,208,190,209,130,208,190,208,188,209,131,209,128,208,
-176,208,177,208,190,209,130,209,131,208,176,208,191,209,128,208,181,208,187,209,
-143,208,178,208,190,208,190,208,177,209,137,208,181,208,190,208,180,208,189,208,
-190,208,179,208,190,209,129,208,178,208,190,208,181,208,179,208,190,209,129,209,
-130,208,176,209,130,209,140,208,184,208,180,209,128,209,131,208,179,208,190,208,
-185,209,132,208,190,209,128,209,131,208,188,208,181,209,133,208,190,209,128,208,
-190,209,136,208,190,208,191,209,128,208,190,209,130,208,184,208,178,209,129,209,
-129,209,139,208,187,208,186,208,176,208,186,208,176,208,182,208,180,209,139,208,
-185,208,178,208,187,208,176,209,129,209,130,208,184,208,179,209,128,209,131,208,
-191,208,191,209,139,208,178,208,188,208,181,209,129,209,130,208,181,209,128,208,
-176,208,177,208,190,209,130,208,176,209,129,208,186,208,176,208,183,208,176,208,
-187,208,191,208,181,209,128,208,178,209,139,208,185,208,180,208,181,208,187,208,
-176,209,130,209,140,208,180,208,181,208,189,209,140,208,179,208,184,208,191,208,
-181,209,128,208,184,208,190,208,180,208,177,208,184,208,183,208,189,208,181,209,
-129,208,190,209,129,208,189,208,190,208,178,208,181,208,188,208,190,208,188,208,
-181,208,189,209,130,208,186,209,131,208,191,208,184,209,130,209,140,208,180,208,
-190,208,187,208,182,208,189,208,176,209,128,208,176,208,188,208,186,208,176,209,
-133,208,189,208,176,209,135,208,176,208,187,208,190,208,160,208,176,208,177,208,
-190,209,130,208,176,208,162,208,190,208,187,209,140,208,186,208,190,209,129,208,
-190,208,178,209,129,208,181,208,188,208,178,209,130,208,190,209,128,208,190,208,
-185,208,189,208,176,209,135,208,176,208,187,208,176,209,129,208,191,208,184,209,
-129,208,190,208,186,209,129,208,187,209,131,208,182,208,177,209,139,209,129,208,
-184,209,129,209,130,208,181,208,188,208,191,208,181,209,135,208,176,209,130,208,
-184,208,189,208,190,208,178,208,190,208,179,208,190,208,191,208,190,208,188,208,
-190,209,137,208,184,209,129,208,176,208,185,209,130,208,190,208,178,208,191,208,
-190,209,135,208,181,208,188,209,131,208,191,208,190,208,188,208,190,209,137,209,
-140,208,180,208,190,208,187,208,182,208,189,208,190,209,129,209,129,209,139,208,
-187,208,186,208,184,208,177,209,139,209,129,209,130,209,128,208,190,208,180,208,
-176,208,189,208,189,209,139,208,181,208,188,208,189,208,190,208,179,208,184,208,
-181,208,191,209,128,208,190,208,181,208,186,209,130,208,161,208,181,208,185,209,
-135,208,176,209,129,208,188,208,190,208,180,208,181,208,187,208,184,209,130,208,
-176,208,186,208,190,208,179,208,190,208,190,208,189,208,187,208,176,208,185,208,
-189,208,179,208,190,209,128,208,190,208,180,208,181,208,178,208,181,209,128,209,
-129,208,184,209,143,209,129,209,130,209,128,208,176,208,189,208,181,209,132,208,
-184,208,187,209,140,208,188,209,139,209,131,209,128,208,190,208,178,208,189,209,
-143,209,128,208,176,208,183,208,189,209,139,209,133,208,184,209,129,208,186,208,
-176,209,130,209,140,208,189,208,181,208,180,208,181,208,187,209,142,209,143,208,
-189,208,178,208,176,209,128,209,143,208,188,208,181,208,189,209,140,209,136,208,
-181,208,188,208,189,208,190,208,179,208,184,209,133,208,180,208,176,208,189,208,
-189,208,190,208,185,208,183,208,189,208,176,209,135,208,184,209,130,208,189,208,
-181,208,187,209,140,208,183,209,143,209,132,208,190,209,128,209,131,208,188,208,
-176,208,162,208,181,208,191,208,181,209,128,209,140,208,188,208,181,209,129,209,
-143,209,134,208,176,208,183,208,176,209,137,208,184,209,130,209,139,208,155,209,
-131,209,135,209,136,208,184,208,181,224,164,168,224,164,185,224,165,128,224,164,
-130,224,164,149,224,164,176,224,164,168,224,165,135,224,164,133,224,164,170,224,
-164,168,224,165,135,224,164,149,224,164,191,224,164,175,224,164,190,224,164,149,
-224,164,176,224,165,135,224,164,130,224,164,133,224,164,168,224,165,141,224,164,
-175,224,164,149,224,165,141,224,164,175,224,164,190,224,164,151,224,164,190,224,
-164,135,224,164,161,224,164,172,224,164,190,224,164,176,224,165,135,224,164,149,
-224,164,191,224,164,184,224,165,128,224,164,166,224,164,191,224,164,175,224,164,
-190,224,164,170,224,164,185,224,164,178,224,165,135,224,164,184,224,164,191,224,
-164,130,224,164,185,224,164,173,224,164,190,224,164,176,224,164,164,224,164,133,
-224,164,170,224,164,168,224,165,128,224,164,181,224,164,190,224,164,178,224,165,
-135,224,164,184,224,165,135,224,164,181,224,164,190,224,164,149,224,164,176,224,
-164,164,224,165,135,224,164,174,224,165,135,224,164,176,224,165,135,224,164,185,
-224,165,139,224,164,168,224,165,135,224,164,184,224,164,149,224,164,164,224,165,
-135,224,164,172,224,164,185,224,165,129,224,164,164,224,164,184,224,164,190,224,
-164,135,224,164,159,224,164,185,224,165,139,224,164,151,224,164,190,224,164,156,
-224,164,190,224,164,168,224,165,135,224,164,174,224,164,191,224,164,168,224,164,
-159,224,164,149,224,164,176,224,164,164,224,164,190,224,164,149,224,164,176,224,
-164,168,224,164,190,224,164,137,224,164,168,224,164,149,224,165,135,224,164,175,
-224,164,185,224,164,190,224,164,129,224,164,184,224,164,172,224,164,184,224,165,
-135,224,164,173,224,164,190,224,164,183,224,164,190,224,164,134,224,164,170,224,
-164,149,224,165,135,224,164,178,224,164,191,224,164,175,224,165,135,224,164,182,
-224,165,129,224,164,176,224,165,130,224,164,135,224,164,184,224,164,149,224,165,
-135,224,164,152,224,164,130,224,164,159,224,165,135,224,164,174,224,165,135,224,
-164,176,224,165,128,224,164,184,224,164,149,224,164,164,224,164,190,224,164,174,
-224,165,135,224,164,176,224,164,190,224,164,178,224,165,135,224,164,149,224,164,
-176,224,164,133,224,164,167,224,164,191,224,164,149,224,164,133,224,164,170,224,
-164,168,224,164,190,224,164,184,224,164,174,224,164,190,224,164,156,224,164,174,
-224,165,129,224,164,157,224,165,135,224,164,149,224,164,190,224,164,176,224,164,
-163,224,164,185,224,165,139,224,164,164,224,164,190,224,164,149,224,164,161,224,
-164,188,224,165,128,224,164,175,224,164,185,224,164,190,224,164,130,224,164,185,
-224,165,139,224,164,159,224,164,178,224,164,182,224,164,172,224,165,141,224,164,
-166,224,164,178,224,164,191,224,164,175,224,164,190,224,164,156,224,165,128,224,
-164,181,224,164,168,224,164,156,224,164,190,224,164,164,224,164,190,224,164,149,
-224,165,136,224,164,184,224,165,135,224,164,134,224,164,170,224,164,149,224,164,
-190,224,164,181,224,164,190,224,164,178,224,165,128,224,164,166,224,165,135,224,
-164,168,224,165,135,224,164,170,224,165,130,224,164,176,224,165,128,224,164,170,
-224,164,190,224,164,168,224,165,128,224,164,137,224,164,184,224,164,149,224,165,
-135,224,164,185,224,165,139,224,164,151,224,165,128,224,164,172,224,165,136,224,
-164,160,224,164,149,224,164,134,224,164,170,224,164,149,224,165,128,224,164,181,
-224,164,176,224,165,141,224,164,183,224,164,151,224,164,190,224,164,130,224,164,
-181,224,164,134,224,164,170,224,164,149,224,165,139,224,164,156,224,164,191,224,
-164,178,224,164,190,224,164,156,224,164,190,224,164,168,224,164,190,224,164,184,
-224,164,185,224,164,174,224,164,164,224,164,185,224,164,174,224,165,135,224,164,
-130,224,164,137,224,164,168,224,164,149,224,165,128,224,164,175,224,164,190,224,
-164,185,224,165,130,224,164,166,224,164,176,224,165,141,224,164,156,224,164,184,
-224,165,130,224,164,154,224,165,128,224,164,170,224,164,184,224,164,130,224,164,
-166,224,164,184,224,164,181,224,164,190,224,164,178,224,164,185,224,165,139,224,
-164,168,224,164,190,224,164,185,224,165,139,224,164,164,224,165,128,224,164,156,
-224,165,136,224,164,184,224,165,135,224,164,181,224,164,190,224,164,170,224,164,
-184,224,164,156,224,164,168,224,164,164,224,164,190,224,164,168,224,165,135,224,
-164,164,224,164,190,224,164,156,224,164,190,224,164,176,224,165,128,224,164,152,
-224,164,190,224,164,175,224,164,178,224,164,156,224,164,191,224,164,178,224,165,
-135,224,164,168,224,165,128,224,164,154,224,165,135,224,164,156,224,164,190,224,
-164,130,224,164,154,224,164,170,224,164,164,224,165,141,224,164,176,224,164,151,
-224,165,130,224,164,151,224,164,178,224,164,156,224,164,190,224,164,164,224,165,
-135,224,164,172,224,164,190,224,164,185,224,164,176,224,164,134,224,164,170,224,
-164,168,224,165,135,224,164,181,224,164,190,224,164,185,224,164,168,224,164,135,
-224,164,184,224,164,149,224,164,190,224,164,184,224,165,129,224,164,172,224,164,
-185,224,164,176,224,164,185,224,164,168,224,165,135,224,164,135,224,164,184,224,
-164,184,224,165,135,224,164,184,224,164,185,224,164,191,224,164,164,224,164,172,
-224,164,161,224,164,188,224,165,135,224,164,152,224,164,159,224,164,168,224,164,
-190,224,164,164,224,164,178,224,164,190,224,164,182,224,164,170,224,164,190,224,
-164,130,224,164,154,224,164,182,224,165,141,224,164,176,224,165,128,224,164,172,
-224,164,161,224,164,188,224,165,128,224,164,185,224,165,139,224,164,164,224,165,
-135,224,164,184,224,164,190,224,164,136,224,164,159,224,164,182,224,164,190,224,
-164,175,224,164,166,224,164,184,224,164,149,224,164,164,224,165,128,224,164,156,
-224,164,190,224,164,164,224,165,128,224,164,181,224,164,190,224,164,178,224,164,
-190,224,164,185,224,164,156,224,164,190,224,164,176,224,164,170,224,164,159,224,
-164,168,224,164,190,224,164,176,224,164,150,224,164,168,224,165,135,224,164,184,
-224,164,161,224,164,188,224,164,149,224,164,174,224,164,191,224,164,178,224,164,
-190,224,164,137,224,164,184,224,164,149,224,165,128,224,164,149,224,165,135,224,
-164,181,224,164,178,224,164,178,224,164,151,224,164,164,224,164,190,224,164,150,
-224,164,190,224,164,168,224,164,190,224,164,133,224,164,176,224,165,141,224,164,
-165,224,164,156,224,164,185,224,164,190,224,164,130,224,164,166,224,165,135,224,
-164,150,224,164,190,224,164,170,224,164,185,224,164,178,224,165,128,224,164,168,
-224,164,191,224,164,175,224,164,174,224,164,172,224,164,191,224,164,168,224,164,
-190,224,164,172,224,165,136,224,164,130,224,164,149,224,164,149,224,164,185,224,
-165,128,224,164,130,224,164,149,224,164,185,224,164,168,224,164,190,224,164,166,
-224,165,135,224,164,164,224,164,190,224,164,185,224,164,174,224,164,178,224,165,
-135,224,164,149,224,164,190,224,164,171,224,165,128,224,164,156,224,164,172,224,
-164,149,224,164,191,224,164,164,224,165,129,224,164,176,224,164,164,224,164,174,
-224,164,190,224,164,130,224,164,151,224,164,181,224,164,185,224,165,128,224,164,
-130,224,164,176,224,165,139,224,164,156,224,164,188,224,164,174,224,164,191,224,
-164,178,224,165,128,224,164,134,224,164,176,224,165,139,224,164,170,224,164,184,
-224,165,135,224,164,168,224,164,190,224,164,175,224,164,190,224,164,166,224,164,
-181,224,164,178,224,165,135,224,164,168,224,165,135,224,164,150,224,164,190,224,
-164,164,224,164,190,224,164,149,224,164,176,224,165,128,224,164,172,224,164,137,
-224,164,168,224,164,149,224,164,190,224,164,156,224,164,181,224,164,190,224,164,
-172,224,164,170,224,165,130,224,164,176,224,164,190,224,164,172,224,164,161,224,
-164,188,224,164,190,224,164,184,224,165,140,224,164,166,224,164,190,224,164,182,
-224,165,135,224,164,175,224,164,176,224,164,149,224,164,191,224,164,175,224,165,
-135,224,164,149,224,164,185,224,164,190,224,164,130,224,164,133,224,164,149,224,
-164,184,224,164,176,224,164,172,224,164,168,224,164,190,224,164,143,224,164,181,
-224,164,185,224,164,190,224,164,130,224,164,184,224,165,141,224,164,165,224,164,
-178,224,164,174,224,164,191,224,164,178,224,165,135,224,164,178,224,165,135,224,
-164,150,224,164,149,224,164,181,224,164,191,224,164,183,224,164,175,224,164,149,
-224,165,141,224,164,176,224,164,130,224,164,184,224,164,174,224,165,130,224,164,
-185,224,164,165,224,164,190,224,164,168,224,164,190,216,170,216,179,216,170,216,
-183,217,138,216,185,217,133,216,180,216,167,216,177,217,131,216,169,216,168,217,
-136,216,167,216,179,216,183,216,169,216,167,217,132,216,181,217,129,216,173,216,
-169,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,174,216,
-167,216,181,216,169,216,167,217,132,217,133,216,178,217,138,216,175,216,167,217,
-132,216,185,216,167,217,133,216,169,216,167,217,132,217,131,216,167,216,170,216,
-168,216,167,217,132,216,177,216,175,217,136,216,175,216,168,216,177,217,134,216,
-167,217,133,216,172,216,167,217,132,216,175,217,136,217,132,216,169,216,167,217,
-132,216,185,216,167,217,132,217,133,216,167,217,132,217,133,217,136,217,130,216,
-185,216,167,217,132,216,185,216,177,216,168,217,138,216,167,217,132,216,179,216,
-177,217,138,216,185,216,167,217,132,216,172,217,136,216,167,217,132,216,167,217,
-132,216,176,217,135,216,167,216,168,216,167,217,132,216,173,217,138,216,167,216,
-169,216,167,217,132,216,173,217,130,217,136,217,130,216,167,217,132,217,131,216,
-177,217,138,217,133,216,167,217,132,216,185,216,177,216,167,217,130,217,133,216,
-173,217,129,217,136,216,184,216,169,216,167,217,132,216,171,216,167,217,134,217,
-138,217,133,216,180,216,167,217,135,216,175,216,169,216,167,217,132,217,133,216,
-177,216,163,216,169,216,167,217,132,217,130,216,177,216,162,217,134,216,167,217,
-132,216,180,216,168,216,167,216,168,216,167,217,132,216,173,217,136,216,167,216,
-177,216,167,217,132,216,172,216,175,217,138,216,175,216,167,217,132,216,163,216,
-179,216,177,216,169,216,167,217,132,216,185,217,132,217,136,217,133,217,133,216,
-172,217,133,217,136,216,185,216,169,216,167,217,132,216,177,216,173,217,133,217,
-134,216,167,217,132,217,134,217,130,216,167,216,183,217,129,217,132,216,179,216,
-183,217,138,217,134,216,167,217,132,217,131,217,136,217,138,216,170,216,167,217,
-132,216,175,217,134,217,138,216,167,216,168,216,177,217,131,216,167,216,170,217,
-135,216,167,217,132,216,177,217,138,216,167,216,182,216,170,216,173,217,138,216,
-167,216,170,217,138,216,168,216,170,217,136,217,130,217,138,216,170,216,167,217,
-132,216,163,217,136,217,132,217,137,216,167,217,132,216,168,216,177,217,138,216,
-175,216,167,217,132,217,131,217,132,216,167,217,133,216,167,217,132,216,177,216,
-167,216,168,216,183,216,167,217,132,216,180,216,174,216,181,217,138,216,179,217,
-138,216,167,216,177,216,167,216,170,216,167,217,132,216,171,216,167,217,132,216,
-171,216,167,217,132,216,181,217,132,216,167,216,169,216,167,217,132,216,173,216,
-175,217,138,216,171,216,167,217,132,216,178,217,136,216,167,216,177,216,167,217,
-132,216,174,217,132,217,138,216,172,216,167,217,132,216,172,217,133,217,138,216,
-185,216,167,217,132,216,185,216,167,217,133,217,135,216,167,217,132,216,172,217,
-133,216,167,217,132,216,167,217,132,216,179,216,167,216,185,216,169,217,133,216,
-180,216,167,217,135,216,175,217,135,216,167,217,132,216,177,216,166,217,138,216,
-179,216,167,217,132,216,175,216,174,217,136,217,132,216,167,217,132,217,129,217,
-134,217,138,216,169,216,167,217,132,217,131,216,170,216,167,216,168,216,167,217,
-132,216,175,217,136,216,177,217,138,216,167,217,132,216,175,216,177,217,136,216,
-179,216,167,216,179,216,170,216,186,216,177,217,130,216,170,216,181,216,167,217,
-133,217,138,217,133,216,167,217,132,216,168,217,134,216,167,216,170,216,167,217,
-132,216,185,216,184,217,138,217,133,101,110,116,101,114,116,97,105,110,109,101,
-110,116,117,110,100,101,114,115,116,97,110,100,105,110,103,32,61,32,102,117,110,
-99,116,105,111,110,40,41,46,106,112,103,34,32,119,105,100,116,104,61,34,99,111,
-110,102,105,103,117,114,97,116,105,111,110,46,112,110,103,34,32,119,105,100,116,
-104,61,34,60,98,111,100,121,32,99,108,97,115,115,61,34,77,97,116,104,46,114,97,
-110,100,111,109,40,41,99,111,110,116,101,109,112,111,114,97,114,121,32,85,110,
-105,116,101,100,32,83,116,97,116,101,115,99,105,114,99,117,109,115,116,97,110,99
-,101,115,46,97,112,112,101,110,100,67,104,105,108,100,40,111,114,103,97,110,105,
-122,97,116,105,111,110,115,60,115,112,97,110,32,99,108,97,115,115,61,34,34,62,60
-,105,109,103,32,115,114,99,61,34,47,100,105,115,116,105,110,103,117,105,115,104,
-101,100,116,104,111,117,115,97,110,100,115,32,111,102,32,99,111,109,109,117,110,
-105,99,97,116,105,111,110,99,108,101,97,114,34,62,60,47,100,105,118,62,105,110,
-118,101,115,116,105,103,97,116,105,111,110,102,97,118,105,99,111,110,46,105,99,
-111,34,32,109,97,114,103,105,110,45,114,105,103,104,116,58,98,97,115,101,100,32,
-111,110,32,116,104,101,32,77,97,115,115,97,99,104,117,115,101,116,116,115,116,97
-,98,108,101,32,98,111,114,100,101,114,61,105,110,116,101,114,110,97,116,105,111,
-110,97,108,97,108,115,111,32,107,110,111,119,110,32,97,115,112,114,111,110,117,
-110,99,105,97,116,105,111,110,98,97,99,107,103,114,111,117,110,100,58,35,102,112
-,97,100,100,105,110,103,45,108,101,102,116,58,70,111,114,32,101,120,97,109,112,
-108,101,44,32,109,105,115,99,101,108,108,97,110,101,111,117,115,38,108,116,59,47
-,109,97,116,104,38,103,116,59,112,115,121,99,104,111,108,111,103,105,99,97,108,
-105,110,32,112,97,114,116,105,99,117,108,97,114,101,97,114,99,104,34,32,116,121,
-112,101,61,34,102,111,114,109,32,109,101,116,104,111,100,61,34,97,115,32,111,112
-,112,111,115,101,100,32,116,111,83,117,112,114,101,109,101,32,67,111,117,114,116
-,111,99,99,97,115,105,111,110,97,108,108,121,32,65,100,100,105,116,105,111,110,
-97,108,108,121,44,78,111,114,116,104,32,65,109,101,114,105,99,97,112,120,59,98,
-97,99,107,103,114,111,117,110,100,111,112,112,111,114,116,117,110,105,116,105,
-101,115,69,110,116,101,114,116,97,105,110,109,101,110,116,46,116,111,76,111,119,
-101,114,67,97,115,101,40,109,97,110,117,102,97,99,116,117,114,105,110,103,112,
-114,111,102,101,115,115,105,111,110,97,108,32,99,111,109,98,105,110,101,100,32,
-119,105,116,104,70,111,114,32,105,110,115,116,97,110,99,101,44,99,111,110,115,
-105,115,116,105,110,103,32,111,102,34,32,109,97,120,108,101,110,103,116,104,61,
-34,114,101,116,117,114,110,32,102,97,108,115,101,59,99,111,110,115,99,105,111,
-117,115,110,101,115,115,77,101,100,105,116,101,114,114,97,110,101,97,110,101,120
-,116,114,97,111,114,100,105,110,97,114,121,97,115,115,97,115,115,105,110,97,116,
-105,111,110,115,117,98,115,101,113,117,101,110,116,108,121,32,98,117,116,116,111
-,110,32,116,121,112,101,61,34,116,104,101,32,110,117,109,98,101,114,32,111,102,
-116,104,101,32,111,114,105,103,105,110,97,108,32,99,111,109,112,114,101,104,101,
-110,115,105,118,101,114,101,102,101,114,115,32,116,111,32,116,104,101,60,47,117,
-108,62,10,60,47,100,105,118,62,10,112,104,105,108,111,115,111,112,104,105,99,97,
-108,108,111,99,97,116,105,111,110,46,104,114,101,102,119,97,115,32,112,117,98,
-108,105,115,104,101,100,83,97,110,32,70,114,97,110,99,105,115,99,111,40,102,117,
-110,99,116,105,111,110,40,41,123,10,60,100,105,118,32,105,100,61,34,109,97,105,
-110,115,111,112,104,105,115,116,105,99,97,116,101,100,109,97,116,104,101,109,97,
-116,105,99,97,108,32,47,104,101,97,100,62,13,10,60,98,111,100,121,115,117,103,
-103,101,115,116,115,32,116,104,97,116,100,111,99,117,109,101,110,116,97,116,105,
-111,110,99,111,110,99,101,110,116,114,97,116,105,111,110,114,101,108,97,116,105,
-111,110,115,104,105,112,115,109,97,121,32,104,97,118,101,32,98,101,101,110,40,
-102,111,114,32,101,120,97,109,112,108,101,44,84,104,105,115,32,97,114,116,105,99
-,108,101,32,105,110,32,115,111,109,101,32,99,97,115,101,115,112,97,114,116,115,
-32,111,102,32,116,104,101,32,100,101,102,105,110,105,116,105,111,110,32,111,102,
-71,114,101,97,116,32,66,114,105,116,97,105,110,32,99,101,108,108,112,97,100,100,
-105,110,103,61,101,113,117,105,118,97,108,101,110,116,32,116,111,112,108,97,99,
-101,104,111,108,100,101,114,61,34,59,32,102,111,110,116,45,115,105,122,101,58,32
-,106,117,115,116,105,102,105,99,97,116,105,111,110,98,101,108,105,101,118,101,
-100,32,116,104,97,116,115,117,102,102,101,114,101,100,32,102,114,111,109,97,116,
-116,101,109,112,116,101,100,32,116,111,32,108,101,97,100,101,114,32,111,102,32,
-116,104,101,99,114,105,112,116,34,32,115,114,99,61,34,47,40,102,117,110,99,116,
-105,111,110,40,41,32,123,97,114,101,32,97,118,97,105,108,97,98,108,101,10,9,60,
-108,105,110,107,32,114,101,108,61,34,32,115,114,99,61,39,104,116,116,112,58,47,
-47,105,110,116,101,114,101,115,116,101,100,32,105,110,99,111,110,118,101,110,116
-,105,111,110,97,108,32,34,32,97,108,116,61,34,34,32,47,62,60,47,97,114,101,32,
-103,101,110,101,114,97,108,108,121,104,97,115,32,97,108,115,111,32,98,101,101,
-110,109,111,115,116,32,112,111,112,117,108,97,114,32,99,111,114,114,101,115,112,
-111,110,100,105,110,103,99,114,101,100,105,116,101,100,32,119,105,116,104,116,
-121,108,101,61,34,98,111,114,100,101,114,58,60,47,97,62,60,47,115,112,97,110,62,
-60,47,46,103,105,102,34,32,119,105,100,116,104,61,34,60,105,102,114,97,109,101,
-32,115,114,99,61,34,116,97,98,108,101,32,99,108,97,115,115,61,34,105,110,108,105
-,110,101,45,98,108,111,99,107,59,97,99,99,111,114,100,105,110,103,32,116,111,32,
-116,111,103,101,116,104,101,114,32,119,105,116,104,97,112,112,114,111,120,105,
-109,97,116,101,108,121,112,97,114,108,105,97,109,101,110,116,97,114,121,109,111,
-114,101,32,97,110,100,32,109,111,114,101,100,105,115,112,108,97,121,58,110,111,
-110,101,59,116,114,97,100,105,116,105,111,110,97,108,108,121,112,114,101,100,111
-,109,105,110,97,110,116,108,121,38,110,98,115,112,59,124,38,110,98,115,112,59,38
-,110,98,115,112,59,60,47,115,112,97,110,62,32,99,101,108,108,115,112,97,99,105,
-110,103,61,60,105,110,112,117,116,32,110,97,109,101,61,34,111,114,34,32,99,111,
-110,116,101,110,116,61,34,99,111,110,116,114,111,118,101,114,115,105,97,108,112,
-114,111,112,101,114,116,121,61,34,111,103,58,47,120,45,115,104,111,99,107,119,97
-,118,101,45,100,101,109,111,110,115,116,114,97,116,105,111,110,115,117,114,114,
-111,117,110,100,101,100,32,98,121,78,101,118,101,114,116,104,101,108,101,115,115
-,44,119,97,115,32,116,104,101,32,102,105,114,115,116,99,111,110,115,105,100,101,
-114,97,98,108,101,32,65,108,116,104,111,117,103,104,32,116,104,101,32,99,111,108
-,108,97,98,111,114,97,116,105,111,110,115,104,111,117,108,100,32,110,111,116,32,
-98,101,112,114,111,112,111,114,116,105,111,110,32,111,102,60,115,112,97,110,32,
-115,116,121,108,101,61,34,107,110,111,119,110,32,97,115,32,116,104,101,32,115,
-104,111,114,116,108,121,32,97,102,116,101,114,102,111,114,32,105,110,115,116,97,
-110,99,101,44,100,101,115,99,114,105,98,101,100,32,97,115,32,47,104,101,97,100,
-62,10,60,98,111,100,121,32,115,116,97,114,116,105,110,103,32,119,105,116,104,105
-,110,99,114,101,97,115,105,110,103,108,121,32,116,104,101,32,102,97,99,116,32,
-116,104,97,116,100,105,115,99,117,115,115,105,111,110,32,111,102,109,105,100,100
-,108,101,32,111,102,32,116,104,101,97,110,32,105,110,100,105,118,105,100,117,97,
-108,100,105,102,102,105,99,117,108,116,32,116,111,32,112,111,105,110,116,32,111,
-102,32,118,105,101,119,104,111,109,111,115,101,120,117,97,108,105,116,121,97,99,
-99,101,112,116,97,110,99,101,32,111,102,60,47,115,112,97,110,62,60,47,100,105,
-118,62,109,97,110,117,102,97,99,116,117,114,101,114,115,111,114,105,103,105,110,
-32,111,102,32,116,104,101,99,111,109,109,111,110,108,121,32,117,115,101,100,105,
-109,112,111,114,116,97,110,99,101,32,111,102,100,101,110,111,109,105,110,97,116,
-105,111,110,115,98,97,99,107,103,114,111,117,110,100,58,32,35,108,101,110,103,
-116,104,32,111,102,32,116,104,101,100,101,116,101,114,109,105,110,97,116,105,111
-,110,97,32,115,105,103,110,105,102,105,99,97,110,116,34,32,98,111,114,100,101,
-114,61,34,48,34,62,114,101,118,111,108,117,116,105,111,110,97,114,121,112,114,
-105,110,99,105,112,108,101,115,32,111,102,105,115,32,99,111,110,115,105,100,101,
-114,101,100,119,97,115,32,100,101,118,101,108,111,112,101,100,73,110,100,111,45,
-69,117,114,111,112,101,97,110,118,117,108,110,101,114,97,98,108,101,32,116,111,
-112,114,111,112,111,110,101,110,116,115,32,111,102,97,114,101,32,115,111,109,101
-,116,105,109,101,115,99,108,111,115,101,114,32,116,111,32,116,104,101,78,101,119
-,32,89,111,114,107,32,67,105,116,121,32,110,97,109,101,61,34,115,101,97,114,99,
-104,97,116,116,114,105,98,117,116,101,100,32,116,111,99,111,117,114,115,101,32,
-111,102,32,116,104,101,109,97,116,104,101,109,97,116,105,99,105,97,110,98,121,32
-,116,104,101,32,101,110,100,32,111,102,97,116,32,116,104,101,32,101,110,100,32,
-111,102,34,32,98,111,114,100,101,114,61,34,48,34,32,116,101,99,104,110,111,108,
-111,103,105,99,97,108,46,114,101,109,111,118,101,67,108,97,115,115,40,98,114,97,
-110,99,104,32,111,102,32,116,104,101,101,118,105,100,101,110,99,101,32,116,104,
-97,116,33,91,101,110,100,105,102,93,45,45,62,13,10,73,110,115,116,105,116,117,
-116,101,32,111,102,32,105,110,116,111,32,97,32,115,105,110,103,108,101,114,101,
-115,112,101,99,116,105,118,101,108,121,46,97,110,100,32,116,104,101,114,101,102,
-111,114,101,112,114,111,112,101,114,116,105,101,115,32,111,102,105,115,32,108,
-111,99,97,116,101,100,32,105,110,115,111,109,101,32,111,102,32,119,104,105,99,
-104,84,104,101,114,101,32,105,115,32,97,108,115,111,99,111,110,116,105,110,117,
-101,100,32,116,111,32,97,112,112,101,97,114,97,110,99,101,32,111,102,32,38,97,
-109,112,59,110,100,97,115,104,59,32,100,101,115,99,114,105,98,101,115,32,116,104
-,101,99,111,110,115,105,100,101,114,97,116,105,111,110,97,117,116,104,111,114,32
-,111,102,32,116,104,101,105,110,100,101,112,101,110,100,101,110,116,108,121,101,
-113,117,105,112,112,101,100,32,119,105,116,104,100,111,101,115,32,110,111,116,32
-,104,97,118,101,60,47,97,62,60,97,32,104,114,101,102,61,34,99,111,110,102,117,
-115,101,100,32,119,105,116,104,60,108,105,110,107,32,104,114,101,102,61,34,47,97
-,116,32,116,104,101,32,97,103,101,32,111,102,97,112,112,101,97,114,32,105,110,32
-,116,104,101,84,104,101,115,101,32,105,110,99,108,117,100,101,114,101,103,97,114
-,100,108,101,115,115,32,111,102,99,111,117,108,100,32,98,101,32,117,115,101,100,
-32,115,116,121,108,101,61,38,113,117,111,116,59,115,101,118,101,114,97,108,32,
-116,105,109,101,115,114,101,112,114,101,115,101,110,116,32,116,104,101,98,111,
-100,121,62,10,60,47,104,116,109,108,62,116,104,111,117,103,104,116,32,116,111,32
-,98,101,112,111,112,117,108,97,116,105,111,110,32,111,102,112,111,115,115,105,98
-,105,108,105,116,105,101,115,112,101,114,99,101,110,116,97,103,101,32,111,102,97
-,99,99,101,115,115,32,116,111,32,116,104,101,97,110,32,97,116,116,101,109,112,
-116,32,116,111,112,114,111,100,117,99,116,105,111,110,32,111,102,106,113,117,101
-,114,121,47,106,113,117,101,114,121,116,119,111,32,100,105,102,102,101,114,101,
-110,116,98,101,108,111,110,103,32,116,111,32,116,104,101,101,115,116,97,98,108,
-105,115,104,109,101,110,116,114,101,112,108,97,99,105,110,103,32,116,104,101,100
-,101,115,99,114,105,112,116,105,111,110,34,32,100,101,116,101,114,109,105,110,
-101,32,116,104,101,97,118,97,105,108,97,98,108,101,32,102,111,114,65,99,99,111,
-114,100,105,110,103,32,116,111,32,119,105,100,101,32,114,97,110,103,101,32,111,
-102,9,60,100,105,118,32,99,108,97,115,115,61,34,109,111,114,101,32,99,111,109,
-109,111,110,108,121,111,114,103,97,110,105,115,97,116,105,111,110,115,102,117,
-110,99,116,105,111,110,97,108,105,116,121,119,97,115,32,99,111,109,112,108,101,
-116,101,100,32,38,97,109,112,59,109,100,97,115,104,59,32,112,97,114,116,105,99,
-105,112,97,116,105,111,110,116,104,101,32,99,104,97,114,97,99,116,101,114,97,110
-,32,97,100,100,105,116,105,111,110,97,108,97,112,112,101,97,114,115,32,116,111,
-32,98,101,102,97,99,116,32,116,104,97,116,32,116,104,101,97,110,32,101,120,97,
-109,112,108,101,32,111,102,115,105,103,110,105,102,105,99,97,110,116,108,121,111
-,110,109,111,117,115,101,111,118,101,114,61,34,98,101,99,97,117,115,101,32,116,
-104,101,121,32,97,115,121,110,99,32,61,32,116,114,117,101,59,112,114,111,98,108,
-101,109,115,32,119,105,116,104,115,101,101,109,115,32,116,111,32,104,97,118,101,
-116,104,101,32,114,101,115,117,108,116,32,111,102,32,115,114,99,61,34,104,116,
-116,112,58,47,47,102,97,109,105,108,105,97,114,32,119,105,116,104,112,111,115,
-115,101,115,115,105,111,110,32,111,102,102,117,110,99,116,105,111,110,32,40,41,
-32,123,116,111,111,107,32,112,108,97,99,101,32,105,110,97,110,100,32,115,111,109
-,101,116,105,109,101,115,115,117,98,115,116,97,110,116,105,97,108,108,121,60,115
-,112,97,110,62,60,47,115,112,97,110,62,105,115,32,111,102,116,101,110,32,117,115
-,101,100,105,110,32,97,110,32,97,116,116,101,109,112,116,103,114,101,97,116,32,
-100,101,97,108,32,111,102,69,110,118,105,114,111,110,109,101,110,116,97,108,115,
-117,99,99,101,115,115,102,117,108,108,121,32,118,105,114,116,117,97,108,108,121,
-32,97,108,108,50,48,116,104,32,99,101,110,116,117,114,121,44,112,114,111,102,101
-,115,115,105,111,110,97,108,115,110,101,99,101,115,115,97,114,121,32,116,111,32,
-100,101,116,101,114,109,105,110,101,100,32,98,121,99,111,109,112,97,116,105,98,
-105,108,105,116,121,98,101,99,97,117,115,101,32,105,116,32,105,115,68,105,99,116
-,105,111,110,97,114,121,32,111,102,109,111,100,105,102,105,99,97,116,105,111,110
-,115,84,104,101,32,102,111,108,108,111,119,105,110,103,109,97,121,32,114,101,102
-,101,114,32,116,111,58,67,111,110,115,101,113,117,101,110,116,108,121,44,73,110,
-116,101,114,110,97,116,105,111,110,97,108,97,108,116,104,111,117,103,104,32,115,
-111,109,101,116,104,97,116,32,119,111,117,108,100,32,98,101,119,111,114,108,100,
-39,115,32,102,105,114,115,116,99,108,97,115,115,105,102,105,101,100,32,97,115,98
-,111,116,116,111,109,32,111,102,32,116,104,101,40,112,97,114,116,105,99,117,108,
-97,114,108,121,97,108,105,103,110,61,34,108,101,102,116,34,32,109,111,115,116,32
-,99,111,109,109,111,110,108,121,98,97,115,105,115,32,102,111,114,32,116,104,101,
-102,111,117,110,100,97,116,105,111,110,32,111,102,99,111,110,116,114,105,98,117,
-116,105,111,110,115,112,111,112,117,108,97,114,105,116,121,32,111,102,99,101,110
-,116,101,114,32,111,102,32,116,104,101,116,111,32,114,101,100,117,99,101,32,116,
-104,101,106,117,114,105,115,100,105,99,116,105,111,110,115,97,112,112,114,111,
-120,105,109,97,116,105,111,110,32,111,110,109,111,117,115,101,111,117,116,61,34,
-78,101,119,32,84,101,115,116,97,109,101,110,116,99,111,108,108,101,99,116,105,
-111,110,32,111,102,60,47,115,112,97,110,62,60,47,97,62,60,47,105,110,32,116,104,
-101,32,85,110,105,116,101,100,102,105,108,109,32,100,105,114,101,99,116,111,114,
-45,115,116,114,105,99,116,46,100,116,100,34,62,104,97,115,32,98,101,101,110,32,
-117,115,101,100,114,101,116,117,114,110,32,116,111,32,116,104,101,97,108,116,104
-,111,117,103,104,32,116,104,105,115,99,104,97,110,103,101,32,105,110,32,116,104,
-101,115,101,118,101,114,97,108,32,111,116,104,101,114,98,117,116,32,116,104,101,
-114,101,32,97,114,101,117,110,112,114,101,99,101,100,101,110,116,101,100,105,115
-,32,115,105,109,105,108,97,114,32,116,111,101,115,112,101,99,105,97,108,108,121,
-32,105,110,119,101,105,103,104,116,58,32,98,111,108,100,59,105,115,32,99,97,108,
-108,101,100,32,116,104,101,99,111,109,112,117,116,97,116,105,111,110,97,108,105,
-110,100,105,99,97,116,101,32,116,104,97,116,114,101,115,116,114,105,99,116,101,
-100,32,116,111,9,60,109,101,116,97,32,110,97,109,101,61,34,97,114,101,32,116,121
-,112,105,99,97,108,108,121,99,111,110,102,108,105,99,116,32,119,105,116,104,72,
-111,119,101,118,101,114,44,32,116,104,101,32,65,110,32,101,120,97,109,112,108,
-101,32,111,102,99,111,109,112,97,114,101,100,32,119,105,116,104,113,117,97,110,
-116,105,116,105,101,115,32,111,102,114,97,116,104,101,114,32,116,104,97,110,32,
-97,99,111,110,115,116,101,108,108,97,116,105,111,110,110,101,99,101,115,115,97,
-114,121,32,102,111,114,114,101,112,111,114,116,101,100,32,116,104,97,116,115,112
-,101,99,105,102,105,99,97,116,105,111,110,112,111,108,105,116,105,99,97,108,32,
-97,110,100,38,110,98,115,112,59,38,110,98,115,112,59,60,114,101,102,101,114,101,
-110,99,101,115,32,116,111,116,104,101,32,115,97,109,101,32,121,101,97,114,71,111
-,118,101,114,110,109,101,110,116,32,111,102,103,101,110,101,114,97,116,105,111,
-110,32,111,102,104,97,118,101,32,110,111,116,32,98,101,101,110,115,101,118,101,
-114,97,108,32,121,101,97,114,115,99,111,109,109,105,116,109,101,110,116,32,116,
-111,9,9,60,117,108,32,99,108,97,115,115,61,34,118,105,115,117,97,108,105,122,97,
-116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,44,112,114,97,99,116
-,105,116,105,111,110,101,114,115,116,104,97,116,32,104,101,32,119,111,117,108,
-100,97,110,100,32,99,111,110,116,105,110,117,101,100,111,99,99,117,112,97,116,
-105,111,110,32,111,102,105,115,32,100,101,102,105,110,101,100,32,97,115,99,101,
-110,116,114,101,32,111,102,32,116,104,101,116,104,101,32,97,109,111,117,110,116,
-32,111,102,62,60,100,105,118,32,115,116,121,108,101,61,34,101,113,117,105,118,97
-,108,101,110,116,32,111,102,100,105,102,102,101,114,101,110,116,105,97,116,101,
-98,114,111,117,103,104,116,32,97,98,111,117,116,109,97,114,103,105,110,45,108,
-101,102,116,58,32,97,117,116,111,109,97,116,105,99,97,108,108,121,116,104,111,
-117,103,104,116,32,111,102,32,97,115,83,111,109,101,32,111,102,32,116,104,101,
-115,101,10,60,100,105,118,32,99,108,97,115,115,61,34,105,110,112,117,116,32,99,
-108,97,115,115,61,34,114,101,112,108,97,99,101,100,32,119,105,116,104,105,115,32
-,111,110,101,32,111,102,32,116,104,101,101,100,117,99,97,116,105,111,110,32,97,
-110,100,105,110,102,108,117,101,110,99,101,100,32,98,121,114,101,112,117,116,97,
-116,105,111,110,32,97,115,10,60,109,101,116,97,32,110,97,109,101,61,34,97,99,99,
-111,109,109,111,100,97,116,105,111,110,60,47,100,105,118,62,10,60,47,100,105,118
-,62,108,97,114,103,101,32,112,97,114,116,32,111,102,73,110,115,116,105,116,117,
-116,101,32,102,111,114,116,104,101,32,115,111,45,99,97,108,108,101,100,32,97,103
-,97,105,110,115,116,32,116,104,101,32,73,110,32,116,104,105,115,32,99,97,115,101
-,44,119,97,115,32,97,112,112,111,105,110,116,101,100,99,108,97,105,109,101,100,
-32,116,111,32,98,101,72,111,119,101,118,101,114,44,32,116,104,105,115,68,101,112
-,97,114,116,109,101,110,116,32,111,102,116,104,101,32,114,101,109,97,105,110,105
-,110,103,101,102,102,101,99,116,32,111,110,32,116,104,101,112,97,114,116,105,99,
-117,108,97,114,108,121,32,100,101,97,108,32,119,105,116,104,32,116,104,101,10,60
-,100,105,118,32,115,116,121,108,101,61,34,97,108,109,111,115,116,32,97,108,119,
-97,121,115,97,114,101,32,99,117,114,114,101,110,116,108,121,101,120,112,114,101,
-115,115,105,111,110,32,111,102,112,104,105,108,111,115,111,112,104,121,32,111,
-102,102,111,114,32,109,111,114,101,32,116,104,97,110,99,105,118,105,108,105,122,
-97,116,105,111,110,115,111,110,32,116,104,101,32,105,115,108,97,110,100,115,101,
-108,101,99,116,101,100,73,110,100,101,120,99,97,110,32,114,101,115,117,108,116,
-32,105,110,34,32,118,97,108,117,101,61,34,34,32,47,62,116,104,101,32,115,116,114
-,117,99,116,117,114,101,32,47,62,60,47,97,62,60,47,100,105,118,62,77,97,110,121,
-32,111,102,32,116,104,101,115,101,99,97,117,115,101,100,32,98,121,32,116,104,101
-,111,102,32,116,104,101,32,85,110,105,116,101,100,115,112,97,110,32,99,108,97,
-115,115,61,34,109,99,97,110,32,98,101,32,116,114,97,99,101,100,105,115,32,114,
-101,108,97,116,101,100,32,116,111,98,101,99,97,109,101,32,111,110,101,32,111,102
-,105,115,32,102,114,101,113,117,101,110,116,108,121,108,105,118,105,110,103,32,
-105,110,32,116,104,101,116,104,101,111,114,101,116,105,99,97,108,108,121,70,111,
-108,108,111,119,105,110,103,32,116,104,101,82,101,118,111,108,117,116,105,111,
-110,97,114,121,103,111,118,101,114,110,109,101,110,116,32,105,110,105,115,32,100
-,101,116,101,114,109,105,110,101,100,116,104,101,32,112,111,108,105,116,105,99,
-97,108,105,110,116,114,111,100,117,99,101,100,32,105,110,115,117,102,102,105,99,
-105,101,110,116,32,116,111,100,101,115,99,114,105,112,116,105,111,110,34,62,115,
-104,111,114,116,32,115,116,111,114,105,101,115,115,101,112,97,114,97,116,105,111
-,110,32,111,102,97,115,32,116,111,32,119,104,101,116,104,101,114,107,110,111,119
-,110,32,102,111,114,32,105,116,115,119,97,115,32,105,110,105,116,105,97,108,108,
-121,100,105,115,112,108,97,121,58,98,108,111,99,107,105,115,32,97,110,32,101,120
-,97,109,112,108,101,116,104,101,32,112,114,105,110,99,105,112,97,108,99,111,110,
-115,105,115,116,115,32,111,102,32,97,114,101,99,111,103,110,105,122,101,100,32,
-97,115,47,98,111,100,121,62,60,47,104,116,109,108,62,97,32,115,117,98,115,116,97
-,110,116,105,97,108,114,101,99,111,110,115,116,114,117,99,116,101,100,104,101,97
-,100,32,111,102,32,115,116,97,116,101,114,101,115,105,115,116,97,110,99,101,32,
-116,111,117,110,100,101,114,103,114,97,100,117,97,116,101,84,104,101,114,101,32,
-97,114,101,32,116,119,111,103,114,97,118,105,116,97,116,105,111,110,97,108,97,
-114,101,32,100,101,115,99,114,105,98,101,100,105,110,116,101,110,116,105,111,110
-,97,108,108,121,115,101,114,118,101,100,32,97,115,32,116,104,101,99,108,97,115,
-115,61,34,104,101,97,100,101,114,111,112,112,111,115,105,116,105,111,110,32,116,
-111,102,117,110,100,97,109,101,110,116,97,108,108,121,100,111,109,105,110,97,116
-,101,100,32,116,104,101,97,110,100,32,116,104,101,32,111,116,104,101,114,97,108,
-108,105,97,110,99,101,32,119,105,116,104,119,97,115,32,102,111,114,99,101,100,32
-,116,111,114,101,115,112,101,99,116,105,118,101,108,121,44,97,110,100,32,112,111
-,108,105,116,105,99,97,108,105,110,32,115,117,112,112,111,114,116,32,111,102,112
-,101,111,112,108,101,32,105,110,32,116,104,101,50,48,116,104,32,99,101,110,116,
-117,114,121,46,97,110,100,32,112,117,98,108,105,115,104,101,100,108,111,97,100,
-67,104,97,114,116,98,101,97,116,116,111,32,117,110,100,101,114,115,116,97,110,
-100,109,101,109,98,101,114,32,115,116,97,116,101,115,101,110,118,105,114,111,110
-,109,101,110,116,97,108,102,105,114,115,116,32,104,97,108,102,32,111,102,99,111,
-117,110,116,114,105,101,115,32,97,110,100,97,114,99,104,105,116,101,99,116,117,
-114,97,108,98,101,32,99,111,110,115,105,100,101,114,101,100,99,104,97,114,97,99,
-116,101,114,105,122,101,100,99,108,101,97,114,73,110,116,101,114,118,97,108,97,
-117,116,104,111,114,105,116,97,116,105,118,101,70,101,100,101,114,97,116,105,111
-,110,32,111,102,119,97,115,32,115,117,99,99,101,101,100,101,100,97,110,100,32,
-116,104,101,114,101,32,97,114,101,97,32,99,111,110,115,101,113,117,101,110,99,
-101,116,104,101,32,80,114,101,115,105,100,101,110,116,97,108,115,111,32,105,110,
-99,108,117,100,101,100,102,114,101,101,32,115,111,102,116,119,97,114,101,115,117
-,99,99,101,115,115,105,111,110,32,111,102,100,101,118,101,108,111,112,101,100,32
-,116,104,101,119,97,115,32,100,101,115,116,114,111,121,101,100,97,119,97,121,32,
-102,114,111,109,32,116,104,101,59,10,60,47,115,99,114,105,112,116,62,10,60,97,
-108,116,104,111,117,103,104,32,116,104,101,121,102,111,108,108,111,119,101,100,
-32,98,121,32,97,109,111,114,101,32,112,111,119,101,114,102,117,108,114,101,115,
-117,108,116,101,100,32,105,110,32,97,85,110,105,118,101,114,115,105,116,121,32,
-111,102,72,111,119,101,118,101,114,44,32,109,97,110,121,116,104,101,32,112,114,
-101,115,105,100,101,110,116,72,111,119,101,118,101,114,44,32,115,111,109,101,105
-,115,32,116,104,111,117,103,104,116,32,116,111,117,110,116,105,108,32,116,104,
-101,32,101,110,100,119,97,115,32,97,110,110,111,117,110,99,101,100,97,114,101,32
-,105,109,112,111,114,116,97,110,116,97,108,115,111,32,105,110,99,108,117,100,101
-,115,62,60,105,110,112,117,116,32,116,121,112,101,61,116,104,101,32,99,101,110,
-116,101,114,32,111,102,32,68,79,32,78,79,84,32,65,76,84,69,82,117,115,101,100,32
-,116,111,32,114,101,102,101,114,116,104,101,109,101,115,47,63,115,111,114,116,61
-,116,104,97,116,32,104,97,100,32,98,101,101,110,116,104,101,32,98,97,115,105,115
-,32,102,111,114,104,97,115,32,100,101,118,101,108,111,112,101,100,105,110,32,116
-,104,101,32,115,117,109,109,101,114,99,111,109,112,97,114,97,116,105,118,101,108
-,121,100,101,115,99,114,105,98,101,100,32,116,104,101,115,117,99,104,32,97,115,
-32,116,104,111,115,101,116,104,101,32,114,101,115,117,108,116,105,110,103,105,
-115,32,105,109,112,111,115,115,105,98,108,101,118,97,114,105,111,117,115,32,111,
-116,104,101,114,83,111,117,116,104,32,65,102,114,105,99,97,110,104,97,118,101,32
-,116,104,101,32,115,97,109,101,101,102,102,101,99,116,105,118,101,110,101,115,
-115,105,110,32,119,104,105,99,104,32,99,97,115,101,59,32,116,101,120,116,45,97,
-108,105,103,110,58,115,116,114,117,99,116,117,114,101,32,97,110,100,59,32,98,97,
-99,107,103,114,111,117,110,100,58,114,101,103,97,114,100,105,110,103,32,116,104,
-101,115,117,112,112,111,114,116,101,100,32,116,104,101,105,115,32,97,108,115,111
-,32,107,110,111,119,110,115,116,121,108,101,61,34,109,97,114,103,105,110,105,110
-,99,108,117,100,105,110,103,32,116,104,101,98,97,104,97,115,97,32,77,101,108,97,
-121,117,110,111,114,115,107,32,98,111,107,109,195,165,108,110,111,114,115,107,32
-,110,121,110,111,114,115,107,115,108,111,118,101,110,197,161,196,141,105,110,97,
-105,110,116,101,114,110,97,99,105,111,110,97,108,99,97,108,105,102,105,99,97,99,
-105,195,179,110,99,111,109,117,110,105,99,97,99,105,195,179,110,99,111,110,115,
-116,114,117,99,99,105,195,179,110,34,62,60,100,105,118,32,99,108,97,115,115,61,
-34,100,105,115,97,109,98,105,103,117,97,116,105,111,110,68,111,109,97,105,110,78
-,97,109,101,39,44,32,39,97,100,109,105,110,105,115,116,114,97,116,105,111,110,
-115,105,109,117,108,116,97,110,101,111,117,115,108,121,116,114,97,110,115,112,
-111,114,116,97,116,105,111,110,73,110,116,101,114,110,97,116,105,111,110,97,108,
-32,109,97,114,103,105,110,45,98,111,116,116,111,109,58,114,101,115,112,111,110,
-115,105,98,105,108,105,116,121,60,33,91,101,110,100,105,102,93,45,45,62,10,60,47
-,62,60,109,101,116,97,32,110,97,109,101,61,34,105,109,112,108,101,109,101,110,
-116,97,116,105,111,110,105,110,102,114,97,115,116,114,117,99,116,117,114,101,114
-,101,112,114,101,115,101,110,116,97,116,105,111,110,98,111,114,100,101,114,45,98
-,111,116,116,111,109,58,60,47,104,101,97,100,62,10,60,98,111,100,121,62,61,104,
-116,116,112,37,51,65,37,50,70,37,50,70,60,102,111,114,109,32,109,101,116,104,111
-,100,61,34,109,101,116,104,111,100,61,34,112,111,115,116,34,32,47,102,97,118,105
-,99,111,110,46,105,99,111,34,32,125,41,59,10,60,47,115,99,114,105,112,116,62,10,
-46,115,101,116,65,116,116,114,105,98,117,116,101,40,65,100,109,105,110,105,115,
-116,114,97,116,105,111,110,61,32,110,101,119,32,65,114,114,97,121,40,41,59,60,33
-,91,101,110,100,105,102,93,45,45,62,13,10,100,105,115,112,108,97,121,58,98,108,
-111,99,107,59,85,110,102,111,114,116,117,110,97,116,101,108,121,44,34,62,38,110,
-98,115,112,59,60,47,100,105,118,62,47,102,97,118,105,99,111,110,46,105,99,111,34
-,62,61,39,115,116,121,108,101,115,104,101,101,116,39,32,105,100,101,110,116,105,
-102,105,99,97,116,105,111,110,44,32,102,111,114,32,101,120,97,109,112,108,101,44
-,60,108,105,62,60,97,32,104,114,101,102,61,34,47,97,110,32,97,108,116,101,114,
-110,97,116,105,118,101,97,115,32,97,32,114,101,115,117,108,116,32,111,102,112,
-116,34,62,60,47,115,99,114,105,112,116,62,10,116,121,112,101,61,34,115,117,98,
-109,105,116,34,32,10,40,102,117,110,99,116,105,111,110,40,41,32,123,114,101,99,
-111,109,109,101,110,100,97,116,105,111,110,102,111,114,109,32,97,99,116,105,111,
-110,61,34,47,116,114,97,110,115,102,111,114,109,97,116,105,111,110,114,101,99,
-111,110,115,116,114,117,99,116,105,111,110,46,115,116,121,108,101,46,100,105,115
-,112,108,97,121,32,65,99,99,111,114,100,105,110,103,32,116,111,32,104,105,100,
-100,101,110,34,32,110,97,109,101,61,34,97,108,111,110,103,32,119,105,116,104,32,
-116,104,101,100,111,99,117,109,101,110,116,46,98,111,100,121,46,97,112,112,114,
-111,120,105,109,97,116,101,108,121,32,67,111,109,109,117,110,105,99,97,116,105,
-111,110,115,112,111,115,116,34,32,97,99,116,105,111,110,61,34,109,101,97,110,105
-,110,103,32,38,113,117,111,116,59,45,45,60,33,91,101,110,100,105,102,93,45,45,62
-,80,114,105,109,101,32,77,105,110,105,115,116,101,114,99,104,97,114,97,99,116,
-101,114,105,115,116,105,99,60,47,97,62,32,60,97,32,99,108,97,115,115,61,116,104,
-101,32,104,105,115,116,111,114,121,32,111,102,32,111,110,109,111,117,115,101,111
-,118,101,114,61,34,116,104,101,32,103,111,118,101,114,110,109,101,110,116,104,
-114,101,102,61,34,104,116,116,112,115,58,47,47,119,97,115,32,111,114,105,103,105
-,110,97,108,108,121,119,97,115,32,105,110,116,114,111,100,117,99,101,100,99,108,
-97,115,115,105,102,105,99,97,116,105,111,110,114,101,112,114,101,115,101,110,116
-,97,116,105,118,101,97,114,101,32,99,111,110,115,105,100,101,114,101,100,60,33,
-91,101,110,100,105,102,93,45,45,62,10,10,100,101,112,101,110,100,115,32,111,110,
-32,116,104,101,85,110,105,118,101,114,115,105,116,121,32,111,102,32,105,110,32,
-99,111,110,116,114,97,115,116,32,116,111,32,112,108,97,99,101,104,111,108,100,
-101,114,61,34,105,110,32,116,104,101,32,99,97,115,101,32,111,102,105,110,116,101
-,114,110,97,116,105,111,110,97,108,32,99,111,110,115,116,105,116,117,116,105,111
-,110,97,108,115,116,121,108,101,61,34,98,111,114,100,101,114,45,58,32,102,117,
-110,99,116,105,111,110,40,41,32,123,66,101,99,97,117,115,101,32,111,102,32,116,
-104,101,45,115,116,114,105,99,116,46,100,116,100,34,62,10,60,116,97,98,108,101,
-32,99,108,97,115,115,61,34,97,99,99,111,109,112,97,110,105,101,100,32,98,121,97,
-99,99,111,117,110,116,32,111,102,32,116,104,101,60,115,99,114,105,112,116,32,115
-,114,99,61,34,47,110,97,116,117,114,101,32,111,102,32,116,104,101,32,116,104,101
-,32,112,101,111,112,108,101,32,105,110,32,105,110,32,97,100,100,105,116,105,111,
-110,32,116,111,115,41,59,32,106,115,46,105,100,32,61,32,105,100,34,32,119,105,
-100,116,104,61,34,49,48,48,37,34,114,101,103,97,114,100,105,110,103,32,116,104,
-101,32,82,111,109,97,110,32,67,97,116,104,111,108,105,99,97,110,32,105,110,100,
-101,112,101,110,100,101,110,116,102,111,108,108,111,119,105,110,103,32,116,104,
-101,32,46,103,105,102,34,32,119,105,100,116,104,61,34,49,116,104,101,32,102,111,
-108,108,111,119,105,110,103,32,100,105,115,99,114,105,109,105,110,97,116,105,111
-,110,97,114,99,104,97,101,111,108,111,103,105,99,97,108,112,114,105,109,101,32,
-109,105,110,105,115,116,101,114,46,106,115,34,62,60,47,115,99,114,105,112,116,62
-,99,111,109,98,105,110,97,116,105,111,110,32,111,102,32,109,97,114,103,105,110,
-119,105,100,116,104,61,34,99,114,101,97,116,101,69,108,101,109,101,110,116,40,
-119,46,97,116,116,97,99,104,69,118,101,110,116,40,60,47,97,62,60,47,116,100,62,
-60,47,116,114,62,115,114,99,61,34,104,116,116,112,115,58,47,47,97,73,110,32,112,
-97,114,116,105,99,117,108,97,114,44,32,97,108,105,103,110,61,34,108,101,102,116,
-34,32,67,122,101,99,104,32,82,101,112,117,98,108,105,99,85,110,105,116,101,100,
-32,75,105,110,103,100,111,109,99,111,114,114,101,115,112,111,110,100,101,110,99,
-101,99,111,110,99,108,117,100,101,100,32,116,104,97,116,46,104,116,109,108,34,32
-,116,105,116,108,101,61,34,40,102,117,110,99,116,105,111,110,32,40,41,32,123,99,
-111,109,101,115,32,102,114,111,109,32,116,104,101,97,112,112,108,105,99,97,116,
-105,111,110,32,111,102,60,115,112,97,110,32,99,108,97,115,115,61,34,115,98,101,
-108,105,101,118,101,100,32,116,111,32,98,101,101,109,101,110,116,40,39,115,99,
-114,105,112,116,39,60,47,97,62,10,60,47,108,105,62,10,60,108,105,118,101,114,121
-,32,100,105,102,102,101,114,101,110,116,62,60,115,112,97,110,32,99,108,97,115,
-115,61,34,111,112,116,105,111,110,32,118,97,108,117,101,61,34,40,97,108,115,111,
-32,107,110,111,119,110,32,97,115,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
-62,60,105,110,112,117,116,32,110,97,109,101,61,34,115,101,112,97,114,97,116,101,
-100,32,102,114,111,109,114,101,102,101,114,114,101,100,32,116,111,32,97,115,32,
-118,97,108,105,103,110,61,34,116,111,112,34,62,102,111,117,110,100,101,114,32,
-111,102,32,116,104,101,97,116,116,101,109,112,116,105,110,103,32,116,111,32,99,
-97,114,98,111,110,32,100,105,111,120,105,100,101,10,10,60,100,105,118,32,99,108,
-97,115,115,61,34,99,108,97,115,115,61,34,115,101,97,114,99,104,45,47,98,111,100,
-121,62,10,60,47,104,116,109,108,62,111,112,112,111,114,116,117,110,105,116,121,
-32,116,111,99,111,109,109,117,110,105,99,97,116,105,111,110,115,60,47,104,101,97
-,100,62,13,10,60,98,111,100,121,32,115,116,121,108,101,61,34,119,105,100,116,104
-,58,84,105,225,186,191,110,103,32,86,105,225,187,135,116,99,104,97,110,103,101,
-115,32,105,110,32,116,104,101,98,111,114,100,101,114,45,99,111,108,111,114,58,35
-,48,34,32,98,111,114,100,101,114,61,34,48,34,32,60,47,115,112,97,110,62,60,47,
-100,105,118,62,60,119,97,115,32,100,105,115,99,111,118,101,114,101,100,34,32,116
-,121,112,101,61,34,116,101,120,116,34,32,41,59,10,60,47,115,99,114,105,112,116,
-62,10,10,68,101,112,97,114,116,109,101,110,116,32,111,102,32,101,99,99,108,101,
-115,105,97,115,116,105,99,97,108,116,104,101,114,101,32,104,97,115,32,98,101,101
-,110,114,101,115,117,108,116,105,110,103,32,102,114,111,109,60,47,98,111,100,121
-,62,60,47,104,116,109,108,62,104,97,115,32,110,101,118,101,114,32,98,101,101,110
-,116,104,101,32,102,105,114,115,116,32,116,105,109,101,105,110,32,114,101,115,
-112,111,110,115,101,32,116,111,97,117,116,111,109,97,116,105,99,97,108,108,121,
-32,60,47,100,105,118,62,10,10,60,100,105,118,32,105,119,97,115,32,99,111,110,115
-,105,100,101,114,101,100,112,101,114,99,101,110,116,32,111,102,32,116,104,101,34
-,32,47,62,60,47,97,62,60,47,100,105,118,62,99,111,108,108,101,99,116,105,111,110
-,32,111,102,32,100,101,115,99,101,110,100,101,100,32,102,114,111,109,115,101,99,
-116,105,111,110,32,111,102,32,116,104,101,97,99,99,101,112,116,45,99,104,97,114,
-115,101,116,116,111,32,98,101,32,99,111,110,102,117,115,101,100,109,101,109,98,
-101,114,32,111,102,32,116,104,101,32,112,97,100,100,105,110,103,45,114,105,103,
-104,116,58,116,114,97,110,115,108,97,116,105,111,110,32,111,102,105,110,116,101,
-114,112,114,101,116,97,116,105,111,110,32,104,114,101,102,61,39,104,116,116,112,
-58,47,47,119,104,101,116,104,101,114,32,111,114,32,110,111,116,84,104,101,114,
-101,32,97,114,101,32,97,108,115,111,116,104,101,114,101,32,97,114,101,32,109,97,
-110,121,97,32,115,109,97,108,108,32,110,117,109,98,101,114,111,116,104,101,114,
-32,112,97,114,116,115,32,111,102,105,109,112,111,115,115,105,98,108,101,32,116,
-111,32,32,99,108,97,115,115,61,34,98,117,116,116,111,110,108,111,99,97,116,101,
-100,32,105,110,32,116,104,101,46,32,72,111,119,101,118,101,114,44,32,116,104,101
-,97,110,100,32,101,118,101,110,116,117,97,108,108,121,65,116,32,116,104,101,32,
-101,110,100,32,111,102,32,98,101,99,97,117,115,101,32,111,102,32,105,116,115,114
-,101,112,114,101,115,101,110,116,115,32,116,104,101,60,102,111,114,109,32,97,99,
-116,105,111,110,61,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,105,
-116,32,105,115,32,112,111,115,115,105,98,108,101,109,111,114,101,32,108,105,107,
-101,108,121,32,116,111,97,110,32,105,110,99,114,101,97,115,101,32,105,110,104,97
-,118,101,32,97,108,115,111,32,98,101,101,110,99,111,114,114,101,115,112,111,110,
-100,115,32,116,111,97,110,110,111,117,110,99,101,100,32,116,104,97,116,97,108,
-105,103,110,61,34,114,105,103,104,116,34,62,109,97,110,121,32,99,111,117,110,116
-,114,105,101,115,102,111,114,32,109,97,110,121,32,121,101,97,114,115,101,97,114,
-108,105,101,115,116,32,107,110,111,119,110,98,101,99,97,117,115,101,32,105,116,
-32,119,97,115,112,116,34,62,60,47,115,99,114,105,112,116,62,13,32,118,97,108,105
-,103,110,61,34,116,111,112,34,32,105,110,104,97,98,105,116,97,110,116,115,32,111
-,102,102,111,108,108,111,119,105,110,103,32,121,101,97,114,13,10,60,100,105,118,
-32,99,108,97,115,115,61,34,109,105,108,108,105,111,110,32,112,101,111,112,108,
-101,99,111,110,116,114,111,118,101,114,115,105,97,108,32,99,111,110,99,101,114,
-110,105,110,103,32,116,104,101,97,114,103,117,101,32,116,104,97,116,32,116,104,
-101,103,111,118,101,114,110,109,101,110,116,32,97,110,100,97,32,114,101,102,101,
-114,101,110,99,101,32,116,111,116,114,97,110,115,102,101,114,114,101,100,32,116,
-111,100,101,115,99,114,105,98,105,110,103,32,116,104,101,32,115,116,121,108,101,
-61,34,99,111,108,111,114,58,97,108,116,104,111,117,103,104,32,116,104,101,114,
-101,98,101,115,116,32,107,110,111,119,110,32,102,111,114,115,117,98,109,105,116,
-34,32,110,97,109,101,61,34,109,117,108,116,105,112,108,105,99,97,116,105,111,110
-,109,111,114,101,32,116,104,97,110,32,111,110,101,32,114,101,99,111,103,110,105,
-116,105,111,110,32,111,102,67,111,117,110,99,105,108,32,111,102,32,116,104,101,
-101,100,105,116,105,111,110,32,111,102,32,116,104,101,32,32,60,109,101,116,97,32
-,110,97,109,101,61,34,69,110,116,101,114,116,97,105,110,109,101,110,116,32,97,
-119,97,121,32,102,114,111,109,32,116,104,101,32,59,109,97,114,103,105,110,45,114
-,105,103,104,116,58,97,116,32,116,104,101,32,116,105,109,101,32,111,102,105,110,
-118,101,115,116,105,103,97,116,105,111,110,115,99,111,110,110,101,99,116,101,100
-,32,119,105,116,104,97,110,100,32,109,97,110,121,32,111,116,104,101,114,97,108,
-116,104,111,117,103,104,32,105,116,32,105,115,98,101,103,105,110,110,105,110,103
-,32,119,105,116,104,32,60,115,112,97,110,32,99,108,97,115,115,61,34,100,101,115,
-99,101,110,100,97,110,116,115,32,111,102,60,115,112,97,110,32,99,108,97,115,115,
-61,34,105,32,97,108,105,103,110,61,34,114,105,103,104,116,34,60,47,104,101,97,
-100,62,10,60,98,111,100,121,32,97,115,112,101,99,116,115,32,111,102,32,116,104,
-101,104,97,115,32,115,105,110,99,101,32,98,101,101,110,69,117,114,111,112,101,97
-,110,32,85,110,105,111,110,114,101,109,105,110,105,115,99,101,110,116,32,111,102
-,109,111,114,101,32,100,105,102,102,105,99,117,108,116,86,105,99,101,32,80,114,
-101,115,105,100,101,110,116,99,111,109,112,111,115,105,116,105,111,110,32,111,
-102,112,97,115,115,101,100,32,116,104,114,111,117,103,104,109,111,114,101,32,105
-,109,112,111,114,116,97,110,116,102,111,110,116,45,115,105,122,101,58,49,49,112,
-120,101,120,112,108,97,110,97,116,105,111,110,32,111,102,116,104,101,32,99,111,
-110,99,101,112,116,32,111,102,119,114,105,116,116,101,110,32,105,110,32,116,104,
-101,9,60,115,112,97,110,32,99,108,97,115,115,61,34,105,115,32,111,110,101,32,111
-,102,32,116,104,101,32,114,101,115,101,109,98,108,97,110,99,101,32,116,111,111,
-110,32,116,104,101,32,103,114,111,117,110,100,115,119,104,105,99,104,32,99,111,
-110,116,97,105,110,115,105,110,99,108,117,100,105,110,103,32,116,104,101,32,100,
-101,102,105,110,101,100,32,98,121,32,116,104,101,112,117,98,108,105,99,97,116,
-105,111,110,32,111,102,109,101,97,110,115,32,116,104,97,116,32,116,104,101,111,
-117,116,115,105,100,101,32,111,102,32,116,104,101,115,117,112,112,111,114,116,32
-,111,102,32,116,104,101,60,105,110,112,117,116,32,99,108,97,115,115,61,34,60,115
-,112,97,110,32,99,108,97,115,115,61,34,116,40,77,97,116,104,46,114,97,110,100,
-111,109,40,41,109,111,115,116,32,112,114,111,109,105,110,101,110,116,100,101,115
-,99,114,105,112,116,105,111,110,32,111,102,67,111,110,115,116,97,110,116,105,110
-,111,112,108,101,119,101,114,101,32,112,117,98,108,105,115,104,101,100,60,100,
-105,118,32,99,108,97,115,115,61,34,115,101,97,112,112,101,97,114,115,32,105,110,
-32,116,104,101,49,34,32,104,101,105,103,104,116,61,34,49,34,32,109,111,115,116,
-32,105,109,112,111,114,116,97,110,116,119,104,105,99,104,32,105,110,99,108,117,
-100,101,115,119,104,105,99,104,32,104,97,100,32,98,101,101,110,100,101,115,116,
-114,117,99,116,105,111,110,32,111,102,116,104,101,32,112,111,112,117,108,97,116,
-105,111,110,10,9,60,100,105,118,32,99,108,97,115,115,61,34,112,111,115,115,105,
-98,105,108,105,116,121,32,111,102,115,111,109,101,116,105,109,101,115,32,117,115
-,101,100,97,112,112,101,97,114,32,116,111,32,104,97,118,101,115,117,99,99,101,
-115,115,32,111,102,32,116,104,101,105,110,116,101,110,100,101,100,32,116,111,32,
-98,101,112,114,101,115,101,110,116,32,105,110,32,116,104,101,115,116,121,108,101
-,61,34,99,108,101,97,114,58,98,13,10,60,47,115,99,114,105,112,116,62,13,10,60,
-119,97,115,32,102,111,117,110,100,101,100,32,105,110,105,110,116,101,114,118,105
-,101,119,32,119,105,116,104,95,105,100,34,32,99,111,110,116,101,110,116,61,34,99
-,97,112,105,116,97,108,32,111,102,32,116,104,101,13,10,60,108,105,110,107,32,114
-,101,108,61,34,115,114,101,108,101,97,115,101,32,111,102,32,116,104,101,112,111,
-105,110,116,32,111,117,116,32,116,104,97,116,120,77,76,72,116,116,112,82,101,113
-,117,101,115,116,97,110,100,32,115,117,98,115,101,113,117,101,110,116,115,101,99
-,111,110,100,32,108,97,114,103,101,115,116,118,101,114,121,32,105,109,112,111,
-114,116,97,110,116,115,112,101,99,105,102,105,99,97,116,105,111,110,115,115,117,
-114,102,97,99,101,32,111,102,32,116,104,101,97,112,112,108,105,101,100,32,116,
-111,32,116,104,101,102,111,114,101,105,103,110,32,112,111,108,105,99,121,95,115,
-101,116,68,111,109,97,105,110,78,97,109,101,101,115,116,97,98,108,105,115,104,
-101,100,32,105,110,105,115,32,98,101,108,105,101,118,101,100,32,116,111,73,110,
-32,97,100,100,105,116,105,111,110,32,116,111,109,101,97,110,105,110,103,32,111,
-102,32,116,104,101,105,115,32,110,97,109,101,100,32,97,102,116,101,114,116,111,
-32,112,114,111,116,101,99,116,32,116,104,101,105,115,32,114,101,112,114,101,115,
-101,110,116,101,100,68,101,99,108,97,114,97,116,105,111,110,32,111,102,109,111,
-114,101,32,101,102,102,105,99,105,101,110,116,67,108,97,115,115,105,102,105,99,
-97,116,105,111,110,111,116,104,101,114,32,102,111,114,109,115,32,111,102,104,101
-,32,114,101,116,117,114,110,101,100,32,116,111,60,115,112,97,110,32,99,108,97,
-115,115,61,34,99,112,101,114,102,111,114,109,97,110,99,101,32,111,102,40,102,117
-,110,99,116,105,111,110,40,41,32,123,13,105,102,32,97,110,100,32,111,110,108,121
-,32,105,102,114,101,103,105,111,110,115,32,111,102,32,116,104,101,108,101,97,100
-,105,110,103,32,116,111,32,116,104,101,114,101,108,97,116,105,111,110,115,32,119
-,105,116,104,85,110,105,116,101,100,32,78,97,116,105,111,110,115,115,116,121,108
-,101,61,34,104,101,105,103,104,116,58,111,116,104,101,114,32,116,104,97,110,32,
-116,104,101,121,112,101,34,32,99,111,110,116,101,110,116,61,34,65,115,115,111,99
-,105,97,116,105,111,110,32,111,102,10,60,47,104,101,97,100,62,10,60,98,111,100,
-121,108,111,99,97,116,101,100,32,111,110,32,116,104,101,105,115,32,114,101,102,
-101,114,114,101,100,32,116,111,40,105,110,99,108,117,100,105,110,103,32,116,104,
-101,99,111,110,99,101,110,116,114,97,116,105,111,110,115,116,104,101,32,105,110,
-100,105,118,105,100,117,97,108,97,109,111,110,103,32,116,104,101,32,109,111,115,
-116,116,104,97,110,32,97,110,121,32,111,116,104,101,114,47,62,10,60,108,105,110,
-107,32,114,101,108,61,34,32,114,101,116,117,114,110,32,102,97,108,115,101,59,116
-,104,101,32,112,117,114,112,111,115,101,32,111,102,116,104,101,32,97,98,105,108,
-105,116,121,32,116,111,59,99,111,108,111,114,58,35,102,102,102,125,10,46,10,60,
-115,112,97,110,32,99,108,97,115,115,61,34,116,104,101,32,115,117,98,106,101,99,
-116,32,111,102,100,101,102,105,110,105,116,105,111,110,115,32,111,102,62,13,10,
-60,108,105,110,107,32,114,101,108,61,34,99,108,97,105,109,32,116,104,97,116,32,
-116,104,101,104,97,118,101,32,100,101,118,101,108,111,112,101,100,60,116,97,98,
-108,101,32,119,105,100,116,104,61,34,99,101,108,101,98,114,97,116,105,111,110,32
-,111,102,70,111,108,108,111,119,105,110,103,32,116,104,101,32,116,111,32,100,105
-,115,116,105,110,103,117,105,115,104,60,115,112,97,110,32,99,108,97,115,115,61,
-34,98,116,97,107,101,115,32,112,108,97,99,101,32,105,110,117,110,100,101,114,32,
-116,104,101,32,110,97,109,101,110,111,116,101,100,32,116,104,97,116,32,116,104,
-101,62,60,33,91,101,110,100,105,102,93,45,45,62,10,115,116,121,108,101,61,34,109
-,97,114,103,105,110,45,105,110,115,116,101,97,100,32,111,102,32,116,104,101,105,
-110,116,114,111,100,117,99,101,100,32,116,104,101,116,104,101,32,112,114,111,99,
-101,115,115,32,111,102,105,110,99,114,101,97,115,105,110,103,32,116,104,101,100,
-105,102,102,101,114,101,110,99,101,115,32,105,110,101,115,116,105,109,97,116,101
-,100,32,116,104,97,116,101,115,112,101,99,105,97,108,108,121,32,116,104,101,47,
-100,105,118,62,60,100,105,118,32,105,100,61,34,119,97,115,32,101,118,101,110,116
-,117,97,108,108,121,116,104,114,111,117,103,104,111,117,116,32,104,105,115,116,
-104,101,32,100,105,102,102,101,114,101,110,99,101,115,111,109,101,116,104,105,
-110,103,32,116,104,97,116,115,112,97,110,62,60,47,115,112,97,110,62,60,47,115,
-105,103,110,105,102,105,99,97,110,116,108,121,32,62,60,47,115,99,114,105,112,116
-,62,13,10,13,10,101,110,118,105,114,111,110,109,101,110,116,97,108,32,116,111,32
-,112,114,101,118,101,110,116,32,116,104,101,104,97,118,101,32,98,101,101,110,32,
-117,115,101,100,101,115,112,101,99,105,97,108,108,121,32,102,111,114,117,110,100
-,101,114,115,116,97,110,100,32,116,104,101,105,115,32,101,115,115,101,110,116,
-105,97,108,108,121,119,101,114,101,32,116,104,101,32,102,105,114,115,116,105,115
-,32,116,104,101,32,108,97,114,103,101,115,116,104,97,118,101,32,98,101,101,110,
-32,109,97,100,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,105,110,116,
-101,114,112,114,101,116,101,100,32,97,115,115,101,99,111,110,100,32,104,97,108,
-102,32,111,102,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,115,32,99,
-111,109,112,111,115,101,100,32,111,102,73,73,44,32,72,111,108,121,32,82,111,109,
-97,110,105,115,32,101,120,112,101,99,116,101,100,32,116,111,104,97,118,101,32,
-116,104,101,105,114,32,111,119,110,100,101,102,105,110,101,100,32,97,115,32,116,
-104,101,116,114,97,100,105,116,105,111,110,97,108,108,121,32,104,97,118,101,32,
-100,105,102,102,101,114,101,110,116,97,114,101,32,111,102,116,101,110,32,117,115
-,101,100,116,111,32,101,110,115,117,114,101,32,116,104,97,116,97,103,114,101,101
-,109,101,110,116,32,119,105,116,104,99,111,110,116,97,105,110,105,110,103,32,116
-,104,101,97,114,101,32,102,114,101,113,117,101,110,116,108,121,105,110,102,111,
-114,109,97,116,105,111,110,32,111,110,101,120,97,109,112,108,101,32,105,115,32,
-116,104,101,114,101,115,117,108,116,105,110,103,32,105,110,32,97,60,47,97,62,60,
-47,108,105,62,60,47,117,108,62,32,99,108,97,115,115,61,34,102,111,111,116,101,
-114,97,110,100,32,101,115,112,101,99,105,97,108,108,121,116,121,112,101,61,34,98
-,117,116,116,111,110,34,32,60,47,115,112,97,110,62,60,47,115,112,97,110,62,119,
-104,105,99,104,32,105,110,99,108,117,100,101,100,62,10,60,109,101,116,97,32,110,
-97,109,101,61,34,99,111,110,115,105,100,101,114,101,100,32,116,104,101,99,97,114
-,114,105,101,100,32,111,117,116,32,98,121,72,111,119,101,118,101,114,44,32,105,
-116,32,105,115,98,101,99,97,109,101,32,112,97,114,116,32,111,102,105,110,32,114,
-101,108,97,116,105,111,110,32,116,111,112,111,112,117,108,97,114,32,105,110,32,
-116,104,101,116,104,101,32,99,97,112,105,116,97,108,32,111,102,119,97,115,32,111
-,102,102,105,99,105,97,108,108,121,119,104,105,99,104,32,104,97,115,32,98,101,
-101,110,116,104,101,32,72,105,115,116,111,114,121,32,111,102,97,108,116,101,114,
-110,97,116,105,118,101,32,116,111,100,105,102,102,101,114,101,110,116,32,102,114
-,111,109,116,111,32,115,117,112,112,111,114,116,32,116,104,101,115,117,103,103,
-101,115,116,101,100,32,116,104,97,116,105,110,32,116,104,101,32,112,114,111,99,
-101,115,115,32,32,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,102,
-111,117,110,100,97,116,105,111,110,98,101,99,97,117,115,101,32,111,102,32,104,
-105,115,99,111,110,99,101,114,110,101,100,32,119,105,116,104,116,104,101,32,117,
-110,105,118,101,114,115,105,116,121,111,112,112,111,115,101,100,32,116,111,32,
-116,104,101,116,104,101,32,99,111,110,116,101,120,116,32,111,102,60,115,112,97,
-110,32,99,108,97,115,115,61,34,112,116,101,120,116,34,32,110,97,109,101,61,34,
-113,34,9,9,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,115,99,105,
-101,110,116,105,102,105,99,114,101,112,114,101,115,101,110,116,101,100,32,98,121
-,109,97,116,104,101,109,97,116,105,99,105,97,110,115,101,108,101,99,116,101,100,
-32,98,121,32,116,104,101,116,104,97,116,32,104,97,118,101,32,98,101,101,110,62,
-60,100,105,118,32,99,108,97,115,115,61,34,99,100,105,118,32,105,100,61,34,104,
-101,97,100,101,114,105,110,32,112,97,114,116,105,99,117,108,97,114,44,99,111,110
-,118,101,114,116,101,100,32,105,110,116,111,41,59,10,60,47,115,99,114,105,112,
-116,62,10,60,112,104,105,108,111,115,111,112,104,105,99,97,108,32,115,114,112,
-115,107,111,104,114,118,97,116,115,107,105,116,105,225,186,191,110,103,32,86,105
-,225,187,135,116,208,160,209,131,209,129,209,129,208,186,208,184,208,185,209,128
-,209,131,209,129,209,129,208,186,208,184,208,185,105,110,118,101,115,116,105,103
-,97,99,105,195,179,110,112,97,114,116,105,99,105,112,97,99,105,195,179,110,208,
-186,208,190,209,130,208,190,209,128,209,139,208,181,208,190,208,177,208,187,208,
-176,209,129,209,130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,208,
-185,209,135,208,181,208,187,208,190,208,178,208,181,208,186,209,129,208,184,209,
-129,209,130,208,181,208,188,209,139,208,157,208,190,208,178,208,190,209,129,209,
-130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,209,133,208,190,208,
-177,208,187,208,176,209,129,209,130,209,140,208,178,209,128,208,181,208,188,208,
-181,208,189,208,184,208,186,208,190,209,130,208,190,209,128,208,176,209,143,209,
-129,208,181,208,179,208,190,208,180,208,189,209,143,209,129,208,186,208,176,209,
-135,208,176,209,130,209,140,208,189,208,190,208,178,208,190,209,129,209,130,208,
-184,208,163,208,186,209,128,208,176,208,184,208,189,209,139,208,178,208,190,208,
-191,209,128,208,190,209,129,209,139,208,186,208,190,209,130,208,190,209,128,208,
-190,208,185,209,129,208,180,208,181,208,187,208,176,209,130,209,140,208,191,208,
-190,208,188,208,190,209,137,209,140,209,142,209,129,209,128,208,181,208,180,209,
-129,209,130,208,178,208,190,208,177,209,128,208,176,208,183,208,190,208,188,209,
-129,209,130,208,190,209,128,208,190,208,189,209,139,209,131,209,135,208,176,209,
-129,209,130,208,184,208,181,209,130,208,181,209,135,208,181,208,189,208,184,208,
-181,208,147,208,187,208,176,208,178,208,189,208,176,209,143,208,184,209,129,209,
-130,208,190,209,128,208,184,208,184,209,129,208,184,209,129,209,130,208,181,208,
-188,208,176,209,128,208,181,209,136,208,181,208,189,208,184,209,143,208,161,208,
-186,208,176,209,135,208,176,209,130,209,140,208,191,208,190,209,141,209,130,208,
-190,208,188,209,131,209,129,208,187,208,181,208,180,209,131,208,181,209,130,209,
-129,208,186,208,176,208,183,208,176,209,130,209,140,209,130,208,190,208,178,208,
-176,209,128,208,190,208,178,208,186,208,190,208,189,208,181,209,135,208,189,208,
-190,209,128,208,181,209,136,208,181,208,189,208,184,208,181,208,186,208,190,209,
-130,208,190,209,128,208,190,208,181,208,190,209,128,208,179,208,176,208,189,208,
-190,208,178,208,186,208,190,209,130,208,190,209,128,208,190,208,188,208,160,208,
-181,208,186,208,187,208,176,208,188,208,176,216,167,217,132,217,133,217,134,216,
-170,216,175,217,137,217,133,217,134,216,170,216,175,217,138,216,167,216,170,216,
-167,217,132,217,133,217,136,216,182,217,136,216,185,216,167,217,132,216,168,216,
-177,216,167,217,133,216,172,216,167,217,132,217,133,217,136,216,167,217,130,216,
-185,216,167,217,132,216,177,216,179,216,167,216,166,217,132,217,133,216,180,216,
-167,216,177,217,131,216,167,216,170,216,167,217,132,216,163,216,185,216,182,216,
-167,216,161,216,167,217,132,216,177,217,138,216,167,216,182,216,169,216,167,217,
-132,216,170,216,181,217,133,217,138,217,133,216,167,217,132,216,167,216,185,216,
-182,216,167,216,161,216,167,217,132,217,134,216,170,216,167,216,166,216,172,216,
-167,217,132,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,170,216,
-179,216,172,217,138,217,132,216,167,217,132,216,163,217,130,216,179,216,167,217,
-133,216,167,217,132,216,182,216,186,216,183,216,167,216,170,216,167,217,132,217,
-129,217,138,216,175,217,138,217,136,216,167,217,132,216,170,216,177,216,173,217,
-138,216,168,216,167,217,132,216,172,216,175,217,138,216,175,216,169,216,167,217,
-132,216,170,216,185,217,132,217,138,217,133,216,167,217,132,216,163,216,174,216,
-168,216,167,216,177,216,167,217,132,216,167,217,129,217,132,216,167,217,133,216,
-167,217,132,216,163,217,129,217,132,216,167,217,133,216,167,217,132,216,170,216,
-167,216,177,217,138,216,174,216,167,217,132,216,170,217,130,217,134,217,138,216,
-169,216,167,217,132,216,167,217,132,216,185,216,167,216,168,216,167,217,132,216,
-174,217,136,216,167,216,183,216,177,216,167,217,132,217,133,216,172,216,170,217,
-133,216,185,216,167,217,132,216,175,217,138,217,131,217,136,216,177,216,167,217,
-132,216,179,217,138,216,167,216,173,216,169,216,185,216,168,216,175,216,167,217,
-132,217,132,217,135,216,167,217,132,216,170,216,177,216,168,217,138,216,169,216,
-167,217,132,216,177,217,136,216,167,216,168,216,183,216,167,217,132,216,163,216,
-175,216,168,217,138,216,169,216,167,217,132,216,167,216,174,216,168,216,167,216,
-177,216,167,217,132,217,133,216,170,216,173,216,175,216,169,216,167,217,132,216,
-167,216,186,216,167,217,134,217,138,99,117,114,115,111,114,58,112,111,105,110,
-116,101,114,59,60,47,116,105,116,108,101,62,10,60,109,101,116,97,32,34,32,104,
-114,101,102,61,34,104,116,116,112,58,47,47,34,62,60,115,112,97,110,32,99,108,97,
-115,115,61,34,109,101,109,98,101,114,115,32,111,102,32,116,104,101,32,119,105,
-110,100,111,119,46,108,111,99,97,116,105,111,110,118,101,114,116,105,99,97,108,
-45,97,108,105,103,110,58,47,97,62,32,124,32,60,97,32,104,114,101,102,61,34,60,33
-,100,111,99,116,121,112,101,32,104,116,109,108,62,109,101,100,105,97,61,34,115,
-99,114,101,101,110,34,32,60,111,112,116,105,111,110,32,118,97,108,117,101,61,34,
-102,97,118,105,99,111,110,46,105,99,111,34,32,47,62,10,9,9,60,100,105,118,32,99,
-108,97,115,115,61,34,99,104,97,114,97,99,116,101,114,105,115,116,105,99,115,34,
-32,109,101,116,104,111,100,61,34,103,101,116,34,32,47,98,111,100,121,62,10,60,47
-,104,116,109,108,62,10,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,
-100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,112,97,100,100,105,110,
-103,45,98,111,116,116,111,109,58,114,101,112,114,101,115,101,110,116,97,116,105,
-118,101,115,115,117,98,109,105,116,34,32,118,97,108,117,101,61,34,97,108,105,103
-,110,61,34,99,101,110,116,101,114,34,32,116,104,114,111,117,103,104,111,117,116,
-32,116,104,101,32,115,99,105,101,110,99,101,32,102,105,99,116,105,111,110,10,32,
-32,60,100,105,118,32,99,108,97,115,115,61,34,115,117,98,109,105,116,34,32,99,108
-,97,115,115,61,34,111,110,101,32,111,102,32,116,104,101,32,109,111,115,116,32,
-118,97,108,105,103,110,61,34,116,111,112,34,62,60,119,97,115,32,101,115,116,97,
-98,108,105,115,104,101,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10,114
-,101,116,117,114,110,32,102,97,108,115,101,59,34,62,41,46,115,116,121,108,101,46
-,100,105,115,112,108,97,121,98,101,99,97,117,115,101,32,111,102,32,116,104,101,
-32,100,111,99,117,109,101,110,116,46,99,111,111,107,105,101,60,102,111,114,109,
-32,97,99,116,105,111,110,61,34,47,125,98,111,100,121,123,109,97,114,103,105,110,
-58,48,59,69,110,99,121,99,108,111,112,101,100,105,97,32,111,102,118,101,114,115,
-105,111,110,32,111,102,32,116,104,101,32,46,99,114,101,97,116,101,69,108,101,109
-,101,110,116,40,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,60,47,100,
-105,118,62,10,60,47,100,105,118,62,10,10,97,100,109,105,110,105,115,116,114,97,
-116,105,118,101,32,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,104,105,
-115,116,111,114,121,32,111,102,32,116,104,101,32,34,62,60,105,110,112,117,116,32
-,116,121,112,101,61,34,112,111,114,116,105,111,110,32,111,102,32,116,104,101,32,
-97,115,32,112,97,114,116,32,111,102,32,116,104,101,32,38,110,98,115,112,59,60,97
-,32,104,114,101,102,61,34,111,116,104,101,114,32,99,111,117,110,116,114,105,101,
-115,34,62,10,60,100,105,118,32,99,108,97,115,115,61,34,60,47,115,112,97,110,62,
-60,47,115,112,97,110,62,60,73,110,32,111,116,104,101,114,32,119,111,114,100,115,
-44,100,105,115,112,108,97,121,58,32,98,108,111,99,107,59,99,111,110,116,114,111,
-108,32,111,102,32,116,104,101,32,105,110,116,114,111,100,117,99,116,105,111,110,
-32,111,102,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,97,115,32,119,101,
-108,108,32,97,115,32,116,104,101,32,105,110,32,114,101,99,101,110,116,32,121,101
-,97,114,115,13,10,9,60,100,105,118,32,99,108,97,115,115,61,34,60,47,100,105,118,
-62,10,9,60,47,100,105,118,62,10,105,110,115,112,105,114,101,100,32,98,121,32,116
-,104,101,116,104,101,32,101,110,100,32,111,102,32,116,104,101,32,99,111,109,112,
-97,116,105,98,108,101,32,119,105,116,104,98,101,99,97,109,101,32,107,110,111,119
-,110,32,97,115,32,115,116,121,108,101,61,34,109,97,114,103,105,110,58,46,106,115
-,34,62,60,47,115,99,114,105,112,116,62,60,32,73,110,116,101,114,110,97,116,105,
-111,110,97,108,32,116,104,101,114,101,32,104,97,118,101,32,98,101,101,110,71,101
-,114,109,97,110,32,108,97,110,103,117,97,103,101,32,115,116,121,108,101,61,34,99
-,111,108,111,114,58,35,67,111,109,109,117,110,105,115,116,32,80,97,114,116,121,
-99,111,110,115,105,115,116,101,110,116,32,119,105,116,104,98,111,114,100,101,114
-,61,34,48,34,32,99,101,108,108,32,109,97,114,103,105,110,104,101,105,103,104,116
-,61,34,116,104,101,32,109,97,106,111,114,105,116,121,32,111,102,34,32,97,108,105
-,103,110,61,34,99,101,110,116,101,114,114,101,108,97,116,101,100,32,116,111,32,
-116,104,101,32,109,97,110,121,32,100,105,102,102,101,114,101,110,116,32,79,114,
-116,104,111,100,111,120,32,67,104,117,114,99,104,115,105,109,105,108,97,114,32,
-116,111,32,116,104,101,32,47,62,10,60,108,105,110,107,32,114,101,108,61,34,115,
-119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,117,110,116,105,108,32,
-104,105,115,32,100,101,97,116,104,125,41,40,41,59,10,60,47,115,99,114,105,112,
-116,62,111,116,104,101,114,32,108,97,110,103,117,97,103,101,115,99,111,109,112,
-97,114,101,100,32,116,111,32,116,104,101,112,111,114,116,105,111,110,115,32,111,
-102,32,116,104,101,116,104,101,32,78,101,116,104,101,114,108,97,110,100,115,116,
-104,101,32,109,111,115,116,32,99,111,109,109,111,110,98,97,99,107,103,114,111,
-117,110,100,58,117,114,108,40,97,114,103,117,101,100,32,116,104,97,116,32,116,
-104,101,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,110,99,108,
-117,100,101,100,32,105,110,32,116,104,101,78,111,114,116,104,32,65,109,101,114,
-105,99,97,110,32,116,104,101,32,110,97,109,101,32,111,102,32,116,104,101,105,110
-,116,101,114,112,114,101,116,97,116,105,111,110,115,116,104,101,32,116,114,97,
-100,105,116,105,111,110,97,108,100,101,118,101,108,111,112,109,101,110,116,32,
-111,102,32,102,114,101,113,117,101,110,116,108,121,32,117,115,101,100,97,32,99,
-111,108,108,101,99,116,105,111,110,32,111,102,118,101,114,121,32,115,105,109,105
-,108,97,114,32,116,111,115,117,114,114,111,117,110,100,105,110,103,32,116,104,
-101,101,120,97,109,112,108,101,32,111,102,32,116,104,105,115,97,108,105,103,110,
-61,34,99,101,110,116,101,114,34,62,119,111,117,108,100,32,104,97,118,101,32,98,
-101,101,110,105,109,97,103,101,95,99,97,112,116,105,111,110,32,61,97,116,116,97,
-99,104,101,100,32,116,111,32,116,104,101,115,117,103,103,101,115,116,105,110,103
-,32,116,104,97,116,105,110,32,116,104,101,32,102,111,114,109,32,111,102,32,105,
-110,118,111,108,118,101,100,32,105,110,32,116,104,101,105,115,32,100,101,114,105
-,118,101,100,32,102,114,111,109,110,97,109,101,100,32,97,102,116,101,114,32,116,
-104,101,73,110,116,114,111,100,117,99,116,105,111,110,32,116,111,114,101,115,116
-,114,105,99,116,105,111,110,115,32,111,110,32,115,116,121,108,101,61,34,119,105,
-100,116,104,58,32,99,97,110,32,98,101,32,117,115,101,100,32,116,111,32,116,104,
-101,32,99,114,101,97,116,105,111,110,32,111,102,109,111,115,116,32,105,109,112,
-111,114,116,97,110,116,32,105,110,102,111,114,109,97,116,105,111,110,32,97,110,
-100,114,101,115,117,108,116,101,100,32,105,110,32,116,104,101,99,111,108,108,97,
-112,115,101,32,111,102,32,116,104,101,84,104,105,115,32,109,101,97,110,115,32,
-116,104,97,116,101,108,101,109,101,110,116,115,32,111,102,32,116,104,101,119,97,
-115,32,114,101,112,108,97,99,101,100,32,98,121,97,110,97,108,121,115,105,115,32,
-111,102,32,116,104,101,105,110,115,112,105,114,97,116,105,111,110,32,102,111,114
-,114,101,103,97,114,100,101,100,32,97,115,32,116,104,101,109,111,115,116,32,115,
-117,99,99,101,115,115,102,117,108,107,110,111,119,110,32,97,115,32,38,113,117,
-111,116,59,97,32,99,111,109,112,114,101,104,101,110,115,105,118,101,72,105,115,
-116,111,114,121,32,111,102,32,116,104,101,32,119,101,114,101,32,99,111,110,115,
-105,100,101,114,101,100,114,101,116,117,114,110,101,100,32,116,111,32,116,104,
-101,97,114,101,32,114,101,102,101,114,114,101,100,32,116,111,85,110,115,111,117,
-114,99,101,100,32,105,109,97,103,101,62,10,9,60,100,105,118,32,99,108,97,115,115
-,61,34,99,111,110,115,105,115,116,115,32,111,102,32,116,104,101,115,116,111,112,
-80,114,111,112,97,103,97,116,105,111,110,105,110,116,101,114,101,115,116,32,105,
-110,32,116,104,101,97,118,97,105,108,97,98,105,108,105,116,121,32,111,102,97,112
-,112,101,97,114,115,32,116,111,32,104,97,118,101,101,108,101,99,116,114,111,109,
-97,103,110,101,116,105,99,101,110,97,98,108,101,83,101,114,118,105,99,101,115,40
-,102,117,110,99,116,105,111,110,32,111,102,32,116,104,101,73,116,32,105,115,32,
-105,109,112,111,114,116,97,110,116,60,47,115,99,114,105,112,116,62,60,47,100,105
-,118,62,102,117,110,99,116,105,111,110,40,41,123,118,97,114,32,114,101,108,97,
-116,105,118,101,32,116,111,32,116,104,101,97,115,32,97,32,114,101,115,117,108,
-116,32,111,102,32,116,104,101,32,112,111,115,105,116,105,111,110,32,111,102,70,
-111,114,32,101,120,97,109,112,108,101,44,32,105,110,32,109,101,116,104,111,100,
-61,34,112,111,115,116,34,32,119,97,115,32,102,111,108,108,111,119,101,100,32,98,
-121,38,97,109,112,59,109,100,97,115,104,59,32,116,104,101,116,104,101,32,97,112,
-112,108,105,99,97,116,105,111,110,106,115,34,62,60,47,115,99,114,105,112,116,62,
-13,10,117,108,62,60,47,100,105,118,62,60,47,100,105,118,62,97,102,116,101,114,32
-,116,104,101,32,100,101,97,116,104,119,105,116,104,32,114,101,115,112,101,99,116
-,32,116,111,115,116,121,108,101,61,34,112,97,100,100,105,110,103,58,105,115,32,
-112,97,114,116,105,99,117,108,97,114,108,121,100,105,115,112,108,97,121,58,105,
-110,108,105,110,101,59,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,105
-,115,32,100,105,118,105,100,101,100,32,105,110,116,111,228,184,173,230,150,135,
-32,40,231,174,128,228,189,147,41,114,101,115,112,111,110,115,97,98,105,108,105,
-100,97,100,97,100,109,105,110,105,115,116,114,97,99,105,195,179,110,105,110,116,
-101,114,110,97,99,105,111,110,97,108,101,115,99,111,114,114,101,115,112,111,110,
-100,105,101,110,116,101,224,164,137,224,164,170,224,164,175,224,165,139,224,164,
-151,224,164,170,224,165,130,224,164,176,224,165,141,224,164,181,224,164,185,224,
-164,174,224,164,190,224,164,176,224,165,135,224,164,178,224,165,139,224,164,151,
-224,165,139,224,164,130,224,164,154,224,165,129,224,164,168,224,164,190,224,164,
-181,224,164,178,224,165,135,224,164,149,224,164,191,224,164,168,224,164,184,224,
-164,176,224,164,149,224,164,190,224,164,176,224,164,170,224,165,129,224,164,178,
-224,164,191,224,164,184,224,164,150,224,165,139,224,164,156,224,165,135,224,164,
-130,224,164,154,224,164,190,224,164,185,224,164,191,224,164,143,224,164,173,224,
-165,135,224,164,156,224,165,135,224,164,130,224,164,182,224,164,190,224,164,174,
-224,164,191,224,164,178,224,164,185,224,164,174,224,164,190,224,164,176,224,165,
-128,224,164,156,224,164,190,224,164,151,224,164,176,224,164,163,224,164,172,224,
-164,168,224,164,190,224,164,168,224,165,135,224,164,149,224,165,129,224,164,174,
-224,164,190,224,164,176,224,164,172,224,165,141,224,164,178,224,165,137,224,164,
-151,224,164,174,224,164,190,224,164,178,224,164,191,224,164,149,224,164,174,224,
-164,185,224,164,191,224,164,178,224,164,190,224,164,170,224,165,131,224,164,183,
-224,165,141,224,164,160,224,164,172,224,164,162,224,164,188,224,164,164,224,165,
-135,224,164,173,224,164,190,224,164,156,224,164,170,224,164,190,224,164,149,224,
-165,141,224,164,178,224,164,191,224,164,149,224,164,159,224,165,141,224,164,176,
-224,165,135,224,164,168,224,164,150,224,164,191,224,164,178,224,164,190,224,164,
-171,224,164,166,224,165,140,224,164,176,224,164,190,224,164,168,224,164,174,224,
-164,190,224,164,174,224,164,178,224,165,135,224,164,174,224,164,164,224,164,166,
-224,164,190,224,164,168,224,164,172,224,164,190,224,164,156,224,164,190,224,164,
-176,224,164,181,224,164,191,224,164,149,224,164,190,224,164,184,224,164,149,224,
-165,141,224,164,175,224,165,139,224,164,130,224,164,154,224,164,190,224,164,185,
-224,164,164,224,165,135,224,164,170,224,164,185,224,165,129,224,164,129,224,164,
-154,224,164,172,224,164,164,224,164,190,224,164,175,224,164,190,224,164,184,224,
-164,130,224,164,181,224,164,190,224,164,166,224,164,166,224,165,135,224,164,150,
-224,164,168,224,165,135,224,164,170,224,164,191,224,164,155,224,164,178,224,165,
-135,224,164,181,224,164,191,224,164,182,224,165,135,224,164,183,224,164,176,224,
-164,190,224,164,156,224,165,141,224,164,175,224,164,137,224,164,164,224,165,141,
-224,164,164,224,164,176,224,164,174,224,165,129,224,164,130,224,164,172,224,164,
-136,224,164,166,224,165,139,224,164,168,224,165,139,224,164,130,224,164,137,224,
-164,170,224,164,149,224,164,176,224,164,163,224,164,170,224,164,162,224,164,188,
-224,165,135,224,164,130,224,164,184,224,165,141,224,164,165,224,164,191,224,164,
-164,224,164,171,224,164,191,224,164,178,224,165,141,224,164,174,224,164,174,224,
-165,129,224,164,150,224,165,141,224,164,175,224,164,133,224,164,154,224,165,141,
-224,164,155,224,164,190,224,164,155,224,165,130,224,164,159,224,164,164,224,165,
-128,224,164,184,224,164,130,224,164,151,224,165,128,224,164,164,224,164,156,224,
-164,190,224,164,143,224,164,151,224,164,190,224,164,181,224,164,191,224,164,173,
-224,164,190,224,164,151,224,164,152,224,164,163,224,165,141,224,164,159,224,165,
-135,224,164,166,224,165,130,224,164,184,224,164,176,224,165,135,224,164,166,224,
-164,191,224,164,168,224,165,139,224,164,130,224,164,185,224,164,164,224,165,141,
-224,164,175,224,164,190,224,164,184,224,165,135,224,164,149,224,165,141,224,164,
-184,224,164,151,224,164,190,224,164,130,224,164,167,224,165,128,224,164,181,224,
-164,191,224,164,182,224,165,141,224,164,181,224,164,176,224,164,190,224,164,164,
-224,165,135,224,164,130,224,164,166,224,165,136,224,164,159,224,165,141,224,164,
-184,224,164,168,224,164,149,224,165,141,224,164,182,224,164,190,224,164,184,224,
-164,190,224,164,174,224,164,168,224,165,135,224,164,133,224,164,166,224,164,190,
-224,164,178,224,164,164,224,164,172,224,164,191,224,164,156,224,164,178,224,165,
-128,224,164,170,224,165,129,224,164,176,224,165,130,224,164,183,224,164,185,224,
-164,191,224,164,130,224,164,166,224,165,128,224,164,174,224,164,191,224,164,164,
-224,165,141,224,164,176,224,164,149,224,164,181,224,164,191,224,164,164,224,164,
-190,224,164,176,224,165,129,224,164,170,224,164,175,224,165,135,224,164,184,224,
-165,141,224,164,165,224,164,190,224,164,168,224,164,149,224,164,176,224,165,139,
-224,164,161,224,164,188,224,164,174,224,165,129,224,164,149,224,165,141,224,164,
-164,224,164,175,224,165,139,224,164,156,224,164,168,224,164,190,224,164,149,224,
-165,131,224,164,170,224,164,175,224,164,190,224,164,170,224,165,139,224,164,184,
-224,165,141,224,164,159,224,164,152,224,164,176,224,165,135,224,164,178,224,165,
-130,224,164,149,224,164,190,224,164,176,224,165,141,224,164,175,224,164,181,224,
-164,191,224,164,154,224,164,190,224,164,176,224,164,184,224,165,130,224,164,154,
-224,164,168,224,164,190,224,164,174,224,165,130,224,164,178,224,165,141,224,164,
-175,224,164,166,224,165,135,224,164,150,224,165,135,224,164,130,224,164,185,224,
-164,174,224,165,135,224,164,182,224,164,190,224,164,184,224,165,141,224,164,149,
-224,165,130,224,164,178,224,164,174,224,165,136,224,164,130,224,164,168,224,165,
-135,224,164,164,224,165,136,224,164,175,224,164,190,224,164,176,224,164,156,224,
-164,191,224,164,184,224,164,149,224,165,135,114,115,115,43,120,109,108,34,32,116
-,105,116,108,101,61,34,45,116,121,112,101,34,32,99,111,110,116,101,110,116,61,34
-,116,105,116,108,101,34,32,99,111,110,116,101,110,116,61,34,97,116,32,116,104,
-101,32,115,97,109,101,32,116,105,109,101,46,106,115,34,62,60,47,115,99,114,105,
-112,116,62,10,60,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,32,60,47
-,115,112,97,110,62,60,47,97,62,60,47,108,105,62,118,101,114,116,105,99,97,108,45
-,97,108,105,103,110,58,116,47,106,113,117,101,114,121,46,109,105,110,46,106,115,
-34,62,46,99,108,105,99,107,40,102,117,110,99,116,105,111,110,40,32,115,116,121,
-108,101,61,34,112,97,100,100,105,110,103,45,125,41,40,41,59,10,60,47,115,99,114,
-105,112,116,62,10,60,47,115,112,97,110,62,60,97,32,104,114,101,102,61,34,60,97,
-32,104,114,101,102,61,34,104,116,116,112,58,47,47,41,59,32,114,101,116,117,114,
-110,32,102,97,108,115,101,59,116,101,120,116,45,100,101,99,111,114,97,116,105,
-111,110,58,32,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,98,111,114,
-100,101,114,45,99,111,108,108,97,112,115,101,58,97,115,115,111,99,105,97,116,101
-,100,32,119,105,116,104,32,66,97,104,97,115,97,32,73,110,100,111,110,101,115,105
-,97,69,110,103,108,105,115,104,32,108,97,110,103,117,97,103,101,60,116,101,120,
-116,32,120,109,108,58,115,112,97,99,101,61,46,103,105,102,34,32,98,111,114,100,
-101,114,61,34,48,34,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,10,111,
-118,101,114,102,108,111,119,58,104,105,100,100,101,110,59,105,109,103,32,115,114
-,99,61,34,104,116,116,112,58,47,47,97,100,100,69,118,101,110,116,76,105,115,116,
-101,110,101,114,114,101,115,112,111,110,115,105,98,108,101,32,102,111,114,32,115
-,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,47,102,97,118,105,99,111,
-110,46,105,99,111,34,32,47,62,111,112,101,114,97,116,105,110,103,32,115,121,115,
-116,101,109,34,32,115,116,121,108,101,61,34,119,105,100,116,104,58,49,116,97,114
-,103,101,116,61,34,95,98,108,97,110,107,34,62,83,116,97,116,101,32,85,110,105,
-118,101,114,115,105,116,121,116,101,120,116,45,97,108,105,103,110,58,108,101,102
-,116,59,10,100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,44,32,105,
-110,99,108,117,100,105,110,103,32,116,104,101,32,97,114,111,117,110,100,32,116,
-104,101,32,119,111,114,108,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10
-,60,34,32,115,116,121,108,101,61,34,104,101,105,103,104,116,58,59,111,118,101,
-114,102,108,111,119,58,104,105,100,100,101,110,109,111,114,101,32,105,110,102,
-111,114,109,97,116,105,111,110,97,110,32,105,110,116,101,114,110,97,116,105,111,
-110,97,108,97,32,109,101,109,98,101,114,32,111,102,32,116,104,101,32,111,110,101
-,32,111,102,32,116,104,101,32,102,105,114,115,116,99,97,110,32,98,101,32,102,111
-,117,110,100,32,105,110,32,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,
-100,105,115,112,108,97,121,58,32,110,111,110,101,59,34,62,34,32,47,62,10,60,108,
-105,110,107,32,114,101,108,61,34,10,32,32,40,102,117,110,99,116,105,111,110,40,
-41,32,123,116,104,101,32,49,53,116,104,32,99,101,110,116,117,114,121,46,112,114,
-101,118,101,110,116,68,101,102,97,117,108,116,40,108,97,114,103,101,32,110,117,
-109,98,101,114,32,111,102,32,66,121,122,97,110,116,105,110,101,32,69,109,112,105
-,114,101,46,106,112,103,124,116,104,117,109,98,124,108,101,102,116,124,118,97,
-115,116,32,109,97,106,111,114,105,116,121,32,111,102,109,97,106,111,114,105,116,
-121,32,111,102,32,116,104,101,32,32,97,108,105,103,110,61,34,99,101,110,116,101,
-114,34,62,85,110,105,118,101,114,115,105,116,121,32,80,114,101,115,115,100,111,
-109,105,110,97,116,101,100,32,98,121,32,116,104,101,83,101,99,111,110,100,32,87,
-111,114,108,100,32,87,97,114,100,105,115,116,114,105,98,117,116,105,111,110,32,
-111,102,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,116,104,
-101,32,114,101,115,116,32,111,102,32,116,104,101,32,99,104,97,114,97,99,116,101,
-114,105,122,101,100,32,98,121,32,114,101,108,61,34,110,111,102,111,108,108,111,
-119,34,62,100,101,114,105,118,101,115,32,102,114,111,109,32,116,104,101,114,97,
-116,104,101,114,32,116,104,97,110,32,116,104,101,32,97,32,99,111,109,98,105,110,
-97,116,105,111,110,32,111,102,115,116,121,108,101,61,34,119,105,100,116,104,58,
-49,48,48,69,110,103,108,105,115,104,45,115,112,101,97,107,105,110,103,99,111,109
-,112,117,116,101,114,32,115,99,105,101,110,99,101,98,111,114,100,101,114,61,34,
-48,34,32,97,108,116,61,34,116,104,101,32,101,120,105,115,116,101,110,99,101,32,
-111,102,68,101,109,111,99,114,97,116,105,99,32,80,97,114,116,121,34,32,115,116,
-121,108,101,61,34,109,97,114,103,105,110,45,70,111,114,32,116,104,105,115,32,114
-,101,97,115,111,110,44,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,9,115
-,66,121,84,97,103,78,97,109,101,40,115,41,91,48,93,106,115,34,62,60,47,115,99,
-114,105,112,116,62,13,10,60,46,106,115,34,62,60,47,115,99,114,105,112,116,62,13,
-10,108,105,110,107,32,114,101,108,61,34,105,99,111,110,34,32,39,32,97,108,116,61
-,39,39,32,99,108,97,115,115,61,39,102,111,114,109,97,116,105,111,110,32,111,102,
-32,116,104,101,118,101,114,115,105,111,110,115,32,111,102,32,116,104,101,32,60,
-47,97,62,60,47,100,105,118,62,60,47,100,105,118,62,47,112,97,103,101,62,10,32,32
-,60,112,97,103,101,62,10,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,
-116,98,101,99,97,109,101,32,116,104,101,32,102,105,114,115,116,98,97,104,97,115,
-97,32,73,110,100,111,110,101,115,105,97,101,110,103,108,105,115,104,32,40,115,
-105,109,112,108,101,41,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
-206,172,209,133,209,128,208,178,208,176,209,130,209,129,208,186,208,184,208,186,
-208,190,208,188,208,191,208,176,208,189,208,184,208,184,209,143,208,178,208,187,
-209,143,208,181,209,130,209,129,209,143,208,148,208,190,208,177,208,176,208,178,
-208,184,209,130,209,140,209,135,208,181,208,187,208,190,208,178,208,181,208,186,
-208,176,209,128,208,176,208,183,208,178,208,184,209,130,208,184,209,143,208,152,
-208,189,209,130,208,181,209,128,208,189,208,181,209,130,208,158,209,130,208,178,
-208,181,209,130,208,184,209,130,209,140,208,189,208,176,208,191,209,128,208,184,
-208,188,208,181,209,128,208,184,208,189,209,130,208,181,209,128,208,189,208,181,
-209,130,208,186,208,190,209,130,208,190,209,128,208,190,208,179,208,190,209,129,
-209,130,209,128,208,176,208,189,208,184,209,134,209,139,208,186,208,176,209,135,
-208,181,209,129,209,130,208,178,208,181,209,131,209,129,208,187,208,190,208,178,
-208,184,209,143,209,133,208,191,209,128,208,190,208,177,208,187,208,181,208,188,
-209,139,208,191,208,190,208,187,209,131,209,135,208,184,209,130,209,140,209,143,
-208,178,208,187,209,143,209,142,209,130,209,129,209,143,208,189,208,176,208,184,
-208,177,208,190,208,187,208,181,208,181,208,186,208,190,208,188,208,191,208,176,
-208,189,208,184,209,143,208,178,208,189,208,184,208,188,208,176,208,189,208,184,
-208,181,209,129,209,128,208,181,208,180,209,129,209,130,208,178,208,176,216,167,
-217,132,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,177,
-216,166,217,138,216,179,217,138,216,169,216,167,217,132,216,167,217,134,216,170,
-217,130,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216,167,216,170,
-217,131,216,167,217,132,216,179,217,138,216,167,216,177,216,167,216,170,216,167,
-217,132,217,133,217,131,216,170,217,136,216,168,216,169,216,167,217,132,216,179,
-216,185,217,136,216,175,217,138,216,169,216,167,216,173,216,181,216,167,216,166,
-217,138,216,167,216,170,216,167,217,132,216,185,216,167,217,132,217,133,217,138,
-216,169,216,167,217,132,216,181,217,136,216,170,217,138,216,167,216,170,216,167,
-217,132,216,167,217,134,216,170,216,177,217,134,216,170,216,167,217,132,216,170,
-216,181,216,167,217,133,217,138,217,133,216,167,217,132,216,165,216,179,217,132,
-216,167,217,133,217,138,216,167,217,132,217,133,216,180,216,167,216,177,217,131,
-216,169,216,167,217,132,217,133,216,177,216,166,217,138,216,167,216,170,114,111,
-98,111,116,115,34,32,99,111,110,116,101,110,116,61,34,60,100,105,118,32,105,100,
-61,34,102,111,111,116,101,114,34,62,116,104,101,32,85,110,105,116,101,100,32,83,
-116,97,116,101,115,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,
-46,106,112,103,124,114,105,103,104,116,124,116,104,117,109,98,124,46,106,115,34,
-62,60,47,115,99,114,105,112,116,62,13,10,60,108,111,99,97,116,105,111,110,46,112
-,114,111,116,111,99,111,108,102,114,97,109,101,98,111,114,100,101,114,61,34,48,
-34,32,115,34,32,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,60,47,97,62,
-60,47,100,105,118,62,60,47,100,105,118,62,60,102,111,110,116,45,119,101,105,103,
-104,116,58,98,111,108,100,59,38,113,117,111,116,59,32,97,110,100,32,38,113,117,
-111,116,59,100,101,112,101,110,100,105,110,103,32,111,110,32,116,104,101,32,109,
-97,114,103,105,110,58,48,59,112,97,100,100,105,110,103,58,34,32,114,101,108,61,
-34,110,111,102,111,108,108,111,119,34,32,80,114,101,115,105,100,101,110,116,32,
-111,102,32,116,104,101,32,116,119,101,110,116,105,101,116,104,32,99,101,110,116,
-117,114,121,101,118,105,115,105,111,110,62,10,32,32,60,47,112,97,103,101,73,110,
-116,101,114,110,101,116,32,69,120,112,108,111,114,101,114,97,46,97,115,121,110,
-99,32,61,32,116,114,117,101,59,13,10,105,110,102,111,114,109,97,116,105,111,110,
-32,97,98,111,117,116,60,100,105,118,32,105,100,61,34,104,101,97,100,101,114,34,
-62,34,32,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,60,97,32,104,114,
-101,102,61,34,104,116,116,112,115,58,47,47,60,100,105,118,32,105,100,61,34,99,
-111,110,116,101,110,116,34,60,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10
-,60,100,101,114,105,118,101,100,32,102,114,111,109,32,116,104,101,32,60,105,109,
-103,32,115,114,99,61,39,104,116,116,112,58,47,47,97,99,99,111,114,100,105,110,
-103,32,116,111,32,116,104,101,32,10,60,47,98,111,100,121,62,10,60,47,104,116,109
-,108,62,10,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,115,
-99,114,105,112,116,32,108,97,110,103,117,97,103,101,61,34,65,114,105,97,108,44,
-32,72,101,108,118,101,116,105,99,97,44,60,47,97,62,60,115,112,97,110,32,99,108,
-97,115,115,61,34,60,47,115,99,114,105,112,116,62,60,115,99,114,105,112,116,32,
-112,111,108,105,116,105,99,97,108,32,112,97,114,116,105,101,115,116,100,62,60,47
-,116,114,62,60,47,116,97,98,108,101,62,60,104,114,101,102,61,34,104,116,116,112,
-58,47,47,119,119,119,46,105,110,116,101,114,112,114,101,116,97,116,105,111,110,
-32,111,102,114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,100,
-111,99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,99,104,97,114,115,101
-,116,61,34,117,116,102,45,56,34,62,10,98,101,103,105,110,110,105,110,103,32,111,
-102,32,116,104,101,32,114,101,118,101,97,108,101,100,32,116,104,97,116,32,116,
-104,101,116,101,108,101,118,105,115,105,111,110,32,115,101,114,105,101,115,34,32
-,114,101,108,61,34,110,111,102,111,108,108,111,119,34,62,32,116,97,114,103,101,
-116,61,34,95,98,108,97,110,107,34,62,99,108,97,105,109,105,110,103,32,116,104,97
-,116,32,116,104,101,104,116,116,112,37,51,65,37,50,70,37,50,70,119,119,119,46,
-109,97,110,105,102,101,115,116,97,116,105,111,110,115,32,111,102,80,114,105,109,
-101,32,77,105,110,105,115,116,101,114,32,111,102,105,110,102,108,117,101,110,99,
-101,100,32,98,121,32,116,104,101,99,108,97,115,115,61,34,99,108,101,97,114,102,
-105,120,34,62,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10,13,10,116,104,
-114,101,101,45,100,105,109,101,110,115,105,111,110,97,108,67,104,117,114,99,104,
-32,111,102,32,69,110,103,108,97,110,100,111,102,32,78,111,114,116,104,32,67,97,
-114,111,108,105,110,97,115,113,117,97,114,101,32,107,105,108,111,109,101,116,114
-,101,115,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,101,114,100,105
-,115,116,105,110,99,116,32,102,114,111,109,32,116,104,101,99,111,109,109,111,110
-,108,121,32,107,110,111,119,110,32,97,115,80,104,111,110,101,116,105,99,32,65,
-108,112,104,97,98,101,116,100,101,99,108,97,114,101,100,32,116,104,97,116,32,116
-,104,101,99,111,110,116,114,111,108,108,101,100,32,98,121,32,116,104,101,66,101,
-110,106,97,109,105,110,32,70,114,97,110,107,108,105,110,114,111,108,101,45,112,
-108,97,121,105,110,103,32,103,97,109,101,116,104,101,32,85,110,105,118,101,114,
-115,105,116,121,32,111,102,105,110,32,87,101,115,116,101,114,110,32,69,117,114,
-111,112,101,112,101,114,115,111,110,97,108,32,99,111,109,112,117,116,101,114,80,
-114,111,106,101,99,116,32,71,117,116,101,110,98,101,114,103,114,101,103,97,114,
-100,108,101,115,115,32,111,102,32,116,104,101,104,97,115,32,98,101,101,110,32,
-112,114,111,112,111,115,101,100,116,111,103,101,116,104,101,114,32,119,105,116,
-104,32,116,104,101,62,60,47,108,105,62,60,108,105,32,99,108,97,115,115,61,34,105
-,110,32,115,111,109,101,32,99,111,117,110,116,114,105,101,115,109,105,110,46,106
-,115,34,62,60,47,115,99,114,105,112,116,62,111,102,32,116,104,101,32,112,111,112
-,117,108,97,116,105,111,110,111,102,102,105,99,105,97,108,32,108,97,110,103,117,
-97,103,101,60,105,109,103,32,115,114,99,61,34,105,109,97,103,101,115,47,105,100,
-101,110,116,105,102,105,101,100,32,98,121,32,116,104,101,110,97,116,117,114,97,
-108,32,114,101,115,111,117,114,99,101,115,99,108,97,115,115,105,102,105,99,97,
-116,105,111,110,32,111,102,99,97,110,32,98,101,32,99,111,110,115,105,100,101,114
-,101,100,113,117,97,110,116,117,109,32,109,101,99,104,97,110,105,99,115,78,101,
-118,101,114,116,104,101,108,101,115,115,44,32,116,104,101,109,105,108,108,105,
-111,110,32,121,101,97,114,115,32,97,103,111,60,47,98,111,100,121,62,13,10,60,47,
-104,116,109,108,62,13,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
-206,172,10,116,97,107,101,32,97,100,118,97,110,116,97,103,101,32,111,102,97,110,
-100,44,32,97,99,99,111,114,100,105,110,103,32,116,111,97,116,116,114,105,98,117,
-116,101,100,32,116,111,32,116,104,101,77,105,99,114,111,115,111,102,116,32,87,
-105,110,100,111,119,115,116,104,101,32,102,105,114,115,116,32,99,101,110,116,117
-,114,121,117,110,100,101,114,32,116,104,101,32,99,111,110,116,114,111,108,100,
-105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,115,104,111,114,116,
-108,121,32,97,102,116,101,114,32,116,104,101,110,111,116,97,98,108,101,32,101,
-120,99,101,112,116,105,111,110,116,101,110,115,32,111,102,32,116,104,111,117,115
-,97,110,100,115,115,101,118,101,114,97,108,32,100,105,102,102,101,114,101,110,
-116,97,114,111,117,110,100,32,116,104,101,32,119,111,114,108,100,46,114,101,97,
-99,104,105,110,103,32,109,105,108,105,116,97,114,121,105,115,111,108,97,116,101,
-100,32,102,114,111,109,32,116,104,101,111,112,112,111,115,105,116,105,111,110,32
-,116,111,32,116,104,101,116,104,101,32,79,108,100,32,84,101,115,116,97,109,101,
-110,116,65,102,114,105,99,97,110,32,65,109,101,114,105,99,97,110,115,105,110,115
-,101,114,116,101,100,32,105,110,116,111,32,116,104,101,115,101,112,97,114,97,116
-,101,32,102,114,111,109,32,116,104,101,109,101,116,114,111,112,111,108,105,116,
-97,110,32,97,114,101,97,109,97,107,101,115,32,105,116,32,112,111,115,115,105,98,
-108,101,97,99,107,110,111,119,108,101,100,103,101,100,32,116,104,97,116,97,114,
-103,117,97,98,108,121,32,116,104,101,32,109,111,115,116,116,121,112,101,61,34,
-116,101,120,116,47,99,115,115,34,62,10,116,104,101,32,73,110,116,101,114,110,97,
-116,105,111,110,97,108,65,99,99,111,114,100,105,110,103,32,116,111,32,116,104,
-101,32,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,99,111,105,110
-,99,105,100,101,32,119,105,116,104,32,116,104,101,116,119,111,45,116,104,105,114
-,100,115,32,111,102,32,116,104,101,68,117,114,105,110,103,32,116,104,105,115,32,
-116,105,109,101,44,100,117,114,105,110,103,32,116,104,101,32,112,101,114,105,111
-,100,97,110,110,111,117,110,99,101,100,32,116,104,97,116,32,104,101,116,104,101,
-32,105,110,116,101,114,110,97,116,105,111,110,97,108,97,110,100,32,109,111,114,
-101,32,114,101,99,101,110,116,108,121,98,101,108,105,101,118,101,100,32,116,104,
-97,116,32,116,104,101,99,111,110,115,99,105,111,117,115,110,101,115,115,32,97,
-110,100,102,111,114,109,101,114,108,121,32,107,110,111,119,110,32,97,115,115,117
-,114,114,111,117,110,100,101,100,32,98,121,32,116,104,101,102,105,114,115,116,32
-,97,112,112,101,97,114,101,100,32,105,110,111,99,99,97,115,105,111,110,97,108,
-108,121,32,117,115,101,100,112,111,115,105,116,105,111,110,58,97,98,115,111,108,
-117,116,101,59,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,112
-,111,115,105,116,105,111,110,58,114,101,108,97,116,105,118,101,59,116,101,120,
-116,45,97,108,105,103,110,58,99,101,110,116,101,114,59,106,97,120,47,108,105,98,
-115,47,106,113,117,101,114,121,47,49,46,98,97,99,107,103,114,111,117,110,100,45,
-99,111,108,111,114,58,35,116,121,112,101,61,34,97,112,112,108,105,99,97,116,105,
-111,110,47,97,110,103,117,97,103,101,34,32,99,111,110,116,101,110,116,61,34,60,
-109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,80,114,105,118,97
-,99,121,32,80,111,108,105,99,121,60,47,97,62,101,40,34,37,51,67,115,99,114,105,
-112,116,32,115,114,99,61,39,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,
-107,34,62,79,110,32,116,104,101,32,111,116,104,101,114,32,104,97,110,100,44,46,
-106,112,103,124,116,104,117,109,98,124,114,105,103,104,116,124,50,60,47,100,105,
-118,62,60,100,105,118,32,99,108,97,115,115,61,34,60,100,105,118,32,115,116,121,
-108,101,61,34,102,108,111,97,116,58,110,105,110,101,116,101,101,110,116,104,32,
-99,101,110,116,117,114,121,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,
-62,13,10,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,115,59,116,
-101,120,116,45,97,108,105,103,110,58,99,101,110,116,101,114,102,111,110,116,45,
-119,101,105,103,104,116,58,32,98,111,108,100,59,32,65,99,99,111,114,100,105,110,
-103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,32,98,
-101,116,119,101,101,110,34,32,102,114,97,109,101,98,111,114,100,101,114,61,34,48
-,34,32,34,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,108,
-105,110,107,32,104,114,101,102,61,34,104,116,116,112,58,47,47,104,116,109,108,52
-,47,108,111,111,115,101,46,100,116,100,34,62,10,100,117,114,105,110,103,32,116,
-104,105,115,32,112,101,114,105,111,100,60,47,116,100,62,60,47,116,114,62,60,47,
-116,97,98,108,101,62,99,108,111,115,101,108,121,32,114,101,108,97,116,101,100,32
-,116,111,102,111,114,32,116,104,101,32,102,105,114,115,116,32,116,105,109,101,59
-,102,111,110,116,45,119,101,105,103,104,116,58,98,111,108,100,59,105,110,112,117
-,116,32,116,121,112,101,61,34,116,101,120,116,34,32,60,115,112,97,110,32,115,116
-,121,108,101,61,34,102,111,110,116,45,111,110,114,101,97,100,121,115,116,97,116,
-101,99,104,97,110,103,101,9,60,100,105,118,32,99,108,97,115,115,61,34,99,108,101
-,97,114,100,111,99,117,109,101,110,116,46,108,111,99,97,116,105,111,110,46,32,70
-,111,114,32,101,120,97,109,112,108,101,44,32,116,104,101,32,97,32,119,105,100,
-101,32,118,97,114,105,101,116,121,32,111,102,32,60,33,68,79,67,84,89,80,69,32,
-104,116,109,108,62,13,10,60,38,110,98,115,112,59,38,110,98,115,112,59,38,110,98,
-115,112,59,34,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,115,116
-,121,108,101,61,34,102,108,111,97,116,58,108,101,102,116,59,99,111,110,99,101,
-114,110,101,100,32,119,105,116,104,32,116,104,101,61,104,116,116,112,37,51,65,37
-,50,70,37,50,70,119,119,119,46,105,110,32,112,111,112,117,108,97,114,32,99,117,
-108,116,117,114,101,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47
-,62,105,116,32,105,115,32,112,111,115,115,105,98,108,101,32,116,111,32,72,97,114
-,118,97,114,100,32,85,110,105,118,101,114,115,105,116,121,116,121,108,101,115,
-104,101,101,116,34,32,104,114,101,102,61,34,47,116,104,101,32,109,97,105,110,32,
-99,104,97,114,97,99,116,101,114,79,120,102,111,114,100,32,85,110,105,118,101,114
-,115,105,116,121,32,32,110,97,109,101,61,34,107,101,121,119,111,114,100,115,34,
-32,99,115,116,121,108,101,61,34,116,101,120,116,45,97,108,105,103,110,58,116,104
-,101,32,85,110,105,116,101,100,32,75,105,110,103,100,111,109,102,101,100,101,114
-,97,108,32,103,111,118,101,114,110,109,101,110,116,60,100,105,118,32,115,116,121
-,108,101,61,34,109,97,114,103,105,110,32,100,101,112,101,110,100,105,110,103,32,
-111,110,32,116,104,101,32,100,101,115,99,114,105,112,116,105,111,110,32,111,102,
-32,116,104,101,60,100,105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,
-46,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,100,101,115,116,
-114,117,99,116,105,111,110,32,111,102,32,116,104,101,115,108,105,103,104,116,108
-,121,32,100,105,102,102,101,114,101,110,116,105,110,32,97,99,99,111,114,100,97,
-110,99,101,32,119,105,116,104,116,101,108,101,99,111,109,109,117,110,105,99,97,
-116,105,111,110,115,105,110,100,105,99,97,116,101,115,32,116,104,97,116,32,116,
-104,101,115,104,111,114,116,108,121,32,116,104,101,114,101,97,102,116,101,114,
-101,115,112,101,99,105,97,108,108,121,32,105,110,32,116,104,101,32,69,117,114,
-111,112,101,97,110,32,99,111,117,110,116,114,105,101,115,72,111,119,101,118,101,
-114,44,32,116,104,101,114,101,32,97,114,101,115,114,99,61,34,104,116,116,112,58,
-47,47,115,116,97,116,105,99,115,117,103,103,101,115,116,101,100,32,116,104,97,
-116,32,116,104,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,
-46,97,32,108,97,114,103,101,32,110,117,109,98,101,114,32,111,102,32,84,101,108,
-101,99,111,109,109,117,110,105,99,97,116,105,111,110,115,34,32,114,101,108,61,34
-,110,111,102,111,108,108,111,119,34,32,116,72,111,108,121,32,82,111,109,97,110,
-32,69,109,112,101,114,111,114,97,108,109,111,115,116,32,101,120,99,108,117,115,
-105,118,101,108,121,34,32,98,111,114,100,101,114,61,34,48,34,32,97,108,116,61,34
-,83,101,99,114,101,116,97,114,121,32,111,102,32,83,116,97,116,101,99,117,108,109
-,105,110,97,116,105,110,103,32,105,110,32,116,104,101,67,73,65,32,87,111,114,108
-,100,32,70,97,99,116,98,111,111,107,116,104,101,32,109,111,115,116,32,105,109,
-112,111,114,116,97,110,116,97,110,110,105,118,101,114,115,97,114,121,32,111,102,
-32,116,104,101,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45
-,60,108,105,62,60,101,109,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,65
-,116,108,97,110,116,105,99,32,79,99,101,97,110,115,116,114,105,99,116,108,121,32
-,115,112,101,97,107,105,110,103,44,115,104,111,114,116,108,121,32,98,101,102,111
-,114,101,32,116,104,101,100,105,102,102,101,114,101,110,116,32,116,121,112,101,
-115,32,111,102,116,104,101,32,79,116,116,111,109,97,110,32,69,109,112,105,114,
-101,62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,65,110,32,73,
-110,116,114,111,100,117,99,116,105,111,110,32,116,111,99,111,110,115,101,113,117
-,101,110,99,101,32,111,102,32,116,104,101,100,101,112,97,114,116,117,114,101,32,
-102,114,111,109,32,116,104,101,67,111,110,102,101,100,101,114,97,116,101,32,83,
-116,97,116,101,115,105,110,100,105,103,101,110,111,117,115,32,112,101,111,112,
-108,101,115,80,114,111,99,101,101,100,105,110,103,115,32,111,102,32,116,104,101,
-105,110,102,111,114,109,97,116,105,111,110,32,111,110,32,116,104,101,116,104,101
-,111,114,105,101,115,32,104,97,118,101,32,98,101,101,110,105,110,118,111,108,118
-,101,109,101,110,116,32,105,110,32,116,104,101,100,105,118,105,100,101,100,32,
-105,110,116,111,32,116,104,114,101,101,97,100,106,97,99,101,110,116,32,99,111,
-117,110,116,114,105,101,115,105,115,32,114,101,115,112,111,110,115,105,98,108,
-101,32,102,111,114,100,105,115,115,111,108,117,116,105,111,110,32,111,102,32,116
-,104,101,99,111,108,108,97,98,111,114,97,116,105,111,110,32,119,105,116,104,119,
-105,100,101,108,121,32,114,101,103,97,114,100,101,100,32,97,115,104,105,115,32,
-99,111,110,116,101,109,112,111,114,97,114,105,101,115,102,111,117,110,100,105,
-110,103,32,109,101,109,98,101,114,32,111,102,68,111,109,105,110,105,99,97,110,32
-,82,101,112,117,98,108,105,99,103,101,110,101,114,97,108,108,121,32,97,99,99,101
-,112,116,101,100,116,104,101,32,112,111,115,115,105,98,105,108,105,116,121,32,
-111,102,97,114,101,32,97,108,115,111,32,97,118,97,105,108,97,98,108,101,117,110,
-100,101,114,32,99,111,110,115,116,114,117,99,116,105,111,110,114,101,115,116,111
-,114,97,116,105,111,110,32,111,102,32,116,104,101,116,104,101,32,103,101,110,101
-,114,97,108,32,112,117,98,108,105,99,105,115,32,97,108,109,111,115,116,32,101,
-110,116,105,114,101,108,121,112,97,115,115,101,115,32,116,104,114,111,117,103,
-104,32,116,104,101,104,97,115,32,98,101,101,110,32,115,117,103,103,101,115,116,
-101,100,99,111,109,112,117,116,101,114,32,97,110,100,32,118,105,100,101,111,71,
-101,114,109,97,110,105,99,32,108,97,110,103,117,97,103,101,115,32,97,99,99,111,
-114,100,105,110,103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110
-,116,32,102,114,111,109,32,116,104,101,115,104,111,114,116,108,121,32,97,102,116
-,101,114,119,97,114,100,115,104,114,101,102,61,34,104,116,116,112,115,58,47,47,
-119,119,119,46,114,101,99,101,110,116,32,100,101,118,101,108,111,112,109,101,110
-,116,66,111,97,114,100,32,111,102,32,68,105,114,101,99,116,111,114,115,60,100,
-105,118,32,99,108,97,115,115,61,34,115,101,97,114,99,104,124,32,60,97,32,104,114
-,101,102,61,34,104,116,116,112,58,47,47,73,110,32,112,97,114,116,105,99,117,108,
-97,114,44,32,116,104,101,77,117,108,116,105,112,108,101,32,102,111,111,116,110,
-111,116,101,115,111,114,32,111,116,104,101,114,32,115,117,98,115,116,97,110,99,
-101,116,104,111,117,115,97,110,100,115,32,111,102,32,121,101,97,114,115,116,114,
-97,110,115,108,97,116,105,111,110,32,111,102,32,116,104,101,60,47,100,105,118,62
-,13,10,60,47,100,105,118,62,13,10,13,10,60,97,32,104,114,101,102,61,34,105,110,
-100,101,120,46,112,104,112,119,97,115,32,101,115,116,97,98,108,105,115,104,101,
-100,32,105,110,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,
-112,97,114,116,105,99,105,112,97,116,101,32,105,110,32,116,104,101,97,32,115,116
-,114,111,110,103,32,105,110,102,108,117,101,110,99,101,115,116,121,108,101,61,34
-,109,97,114,103,105,110,45,116,111,112,58,114,101,112,114,101,115,101,110,116,
-101,100,32,98,121,32,116,104,101,103,114,97,100,117,97,116,101,100,32,102,114,
-111,109,32,116,104,101,84,114,97,100,105,116,105,111,110,97,108,108,121,44,32,
-116,104,101,69,108,101,109,101,110,116,40,34,115,99,114,105,112,116,34,41,59,72,
-111,119,101,118,101,114,44,32,115,105,110,99,101,32,116,104,101,47,100,105,118,
-62,10,60,47,100,105,118,62,10,60,100,105,118,32,108,101,102,116,59,32,109,97,114
-,103,105,110,45,108,101,102,116,58,112,114,111,116,101,99,116,105,111,110,32,97,
-103,97,105,110,115,116,48,59,32,118,101,114,116,105,99,97,108,45,97,108,105,103,
-110,58,85,110,102,111,114,116,117,110,97,116,101,108,121,44,32,116,104,101,116,
-121,112,101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,47,100,105,118,62,
-10,60,100,105,118,32,99,108,97,115,115,61,34,32,99,108,97,115,115,61,34,99,108,
-101,97,114,102,105,120,34,62,60,100,105,118,32,99,108,97,115,115,61,34,102,111,
-111,116,101,114,9,9,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,116,104,
-101,32,109,111,116,105,111,110,32,112,105,99,116,117,114,101,208,145,209,138,208
-,187,208,179,208,176,209,128,209,129,208,186,208,184,208,177,209,138,208,187,208
-,179,208,176,209,128,209,129,208,186,208,184,208,164,208,181,208,180,208,181,209
-,128,208,176,209,134,208,184,208,184,208,189,208,181,209,129,208,186,208,190,208
-,187,209,140,208,186,208,190,209,129,208,190,208,190,208,177,209,137,208,181,208
-,189,208,184,208,181,209,129,208,190,208,190,208,177,209,137,208,181,208,189,208
-,184,209,143,208,191,209,128,208,190,208,179,209,128,208,176,208,188,208,188,209
-,139,208,158,209,130,208,191,209,128,208,176,208,178,208,184,209,130,209,140,208
-,177,208,181,209,129,208,191,208,187,208,176,209,130,208,189,208,190,208,188,208
-,176,209,130,208,181,209,128,208,184,208,176,208,187,209,139,208,191,208,190,208
-,183,208,178,208,190,208,187,209,143,208,181,209,130,208,191,208,190,209,129,208
-,187,208,181,208,180,208,189,208,184,208,181,209,128,208,176,208,183,208,187,208
-,184,209,135,208,189,209,139,209,133,208,191,209,128,208,190,208,180,209,131,208
-,186,209,134,208,184,208,184,208,191,209,128,208,190,208,179,209,128,208,176,208
-,188,208,188,208,176,208,191,208,190,208,187,208,189,208,190,209,129,209,130,209
-,140,209,142,208,189,208,176,209,133,208,190,208,180,208,184,209,130,209,129,209
-,143,208,184,208,183,208,177,209,128,208,176,208,189,208,189,208,190,208,181,208
-,189,208,176,209,129,208,181,208,187,208,181,208,189,208,184,209,143,208,184,208
-,183,208,188,208,181,208,189,208,181,208,189,208,184,209,143,208,186,208,176,209
-,130,208,181,208,179,208,190,209,128,208,184,208,184,208,144,208,187,208,181,208
-,186,209,129,208,176,208,189,208,180,209,128,224,164,166,224,165,141,224,164,181
-,224,164,190,224,164,176,224,164,190,224,164,174,224,165,136,224,164,168,224,165
-,129,224,164,133,224,164,178,224,164,170,224,165,141,224,164,176,224,164,166,224
-,164,190,224,164,168,224,164,173,224,164,190,224,164,176,224,164,164,224,165,128
-,224,164,175,224,164,133,224,164,168,224,165,129,224,164,166,224,165,135,224,164
-,182,224,164,185,224,164,191,224,164,168,224,165,141,224,164,166,224,165,128,224
-,164,135,224,164,130,224,164,161,224,164,191,224,164,175,224,164,190,224,164,166
-,224,164,191,224,164,178,224,165,141,224,164,178,224,165,128,224,164,133,224,164
-,167,224,164,191,224,164,149,224,164,190,224,164,176,224,164,181,224,165,128,224
-,164,161,224,164,191,224,164,175,224,165,139,224,164,154,224,164,191,224,164,159
-,224,165,141,224,164,160,224,165,135,224,164,184,224,164,174,224,164,190,224,164
-,154,224,164,190,224,164,176,224,164,156,224,164,130,224,164,149,224,165,141,224
-,164,182,224,164,168,224,164,166,224,165,129,224,164,168,224,164,191,224,164,175
-,224,164,190,224,164,170,224,165,141,224,164,176,224,164,175,224,165,139,224,164
-,151,224,164,133,224,164,168,224,165,129,224,164,184,224,164,190,224,164,176,224
-,164,145,224,164,168,224,164,178,224,164,190,224,164,135,224,164,168,224,164,170
-,224,164,190,224,164,176,224,165,141,224,164,159,224,165,128,224,164,182,224,164
-,176,224,165,141,224,164,164,224,165,139,224,164,130,224,164,178,224,165,139,224
-,164,149,224,164,184,224,164,173,224,164,190,224,164,171,224,164,188,224,165,141
-,224,164,178,224,165,136,224,164,182,224,164,182,224,164,176,224,165,141,224,164
-,164,224,165,135,224,164,130,224,164,170,224,165,141,224,164,176,224,164,166,224
-,165,135,224,164,182,224,164,170,224,165,141,224,164,178,224,165,135,224,164,175
-,224,164,176,224,164,149,224,165,135,224,164,130,224,164,166,224,165,141,224,164
-,176,224,164,184,224,165,141,224,164,165,224,164,191,224,164,164,224,164,191,224
-,164,137,224,164,164,224,165,141,224,164,170,224,164,190,224,164,166,224,164,137
-,224,164,168,224,165,141,224,164,185,224,165,135,224,164,130,224,164,154,224,164
-,191,224,164,159,224,165,141,224,164,160,224,164,190,224,164,175,224,164,190,224
-,164,164,224,165,141,224,164,176,224,164,190,224,164,156,224,165,141,224,164,175
-,224,164,190,224,164,166,224,164,190,224,164,170,224,165,129,224,164,176,224,164
-,190,224,164,168,224,165,135,224,164,156,224,165,139,224,164,161,224,164,188,224
-,165,135,224,164,130,224,164,133,224,164,168,224,165,129,224,164,181,224,164,190
-,224,164,166,224,164,182,224,165,141,224,164,176,224,165,135,224,164,163,224,165
-,128,224,164,182,224,164,191,224,164,149,224,165,141,224,164,183,224,164,190,224
-,164,184,224,164,176,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184
-,224,164,130,224,164,151,224,165,141,224,164,176,224,164,185,224,164,170,224,164
-,176,224,164,191,224,164,163,224,164,190,224,164,174,224,164,172,224,165,141,224
-,164,176,224,164,190,224,164,130,224,164,161,224,164,172,224,164,154,224,165,141
-,224,164,154,224,165,139,224,164,130,224,164,137,224,164,170,224,164,178,224,164
-,172,224,165,141,224,164,167,224,164,174,224,164,130,224,164,164,224,165,141,224
-,164,176,224,165,128,224,164,184,224,164,130,224,164,170,224,164,176,224,165,141
-,224,164,149,224,164,137,224,164,174,224,165,141,224,164,174,224,165,128,224,164
-,166,224,164,174,224,164,190,224,164,167,224,165,141,224,164,175,224,164,174,224
-,164,184,224,164,185,224,164,190,224,164,175,224,164,164,224,164,190,224,164,182
-,224,164,172,224,165,141,224,164,166,224,165,139,224,164,130,224,164,174,224,165
-,128,224,164,161,224,164,191,224,164,175,224,164,190,224,164,134,224,164,136,224
-,164,170,224,165,128,224,164,143,224,164,178,224,164,174,224,165,139,224,164,172
-,224,164,190,224,164,135,224,164,178,224,164,184,224,164,130,224,164,150,224,165
-,141,224,164,175,224,164,190,224,164,134,224,164,170,224,164,176,224,165,135,224
-,164,182,224,164,168,224,164,133,224,164,168,224,165,129,224,164,172,224,164,130
-,224,164,167,224,164,172,224,164,190,224,164,156,224,164,188,224,164,190,224,164
-,176,224,164,168,224,164,181,224,165,128,224,164,168,224,164,164,224,164,174,224
-,164,170,224,165,141,224,164,176,224,164,174,224,165,129,224,164,150,224,164,170
-,224,165,141,224,164,176,224,164,182,224,165,141,224,164,168,224,164,170,224,164
-,176,224,164,191,224,164,181,224,164,190,224,164,176,224,164,168,224,165,129,224
-,164,149,224,164,184,224,164,190,224,164,168,224,164,184,224,164,174,224,164,176
-,224,165,141,224,164,165,224,164,168,224,164,134,224,164,175,224,165,139,224,164
-,156,224,164,191,224,164,164,224,164,184,224,165,139,224,164,174,224,164,181,224
-,164,190,224,164,176,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216
-,167,216,170,216,167,217,132,217,133,217,134,216,170,216,175,217,138,216,167,216
-,170,216,167,217,132,217,131,217,133,216,168,217,138,217,136,216,170,216,177,216
-,167,217,132,217,133,216,180,216,167,217,135,216,175,216,167,216,170,216,185,216
-,175,216,175,216,167,217,132,216,178,217,136,216,167,216,177,216,185,216,175,216
-,175,216,167,217,132,216,177,216,175,217,136,216,175,216,167,217,132,216,165,216
-,179,217,132,216,167,217,133,217,138,216,169,216,167,217,132,217,129,217,136,216
-,170,217,136,216,180,217,136,216,168,216,167,217,132,217,133,216,179,216,167,216
-,168,217,130,216,167,216,170,216,167,217,132,217,133,216,185,217,132,217,136,217
-,133,216,167,216,170,216,167,217,132,217,133,216,179,217,132,216,179,217,132,216
-,167,216,170,216,167,217,132,216,172,216,177,216,167,217,129,217,138,217,131,216
-,179,216,167,217,132,216,167,216,179,217,132,216,167,217,133,217,138,216,169,216
-,167,217,132,216,167,216,170,216,181,216,167,217,132,216,167,216,170,107,101,121
-,119,111,114,100,115,34,32,99,111,110,116,101,110,116,61,34,119,51,46,111,114,
-103,47,49,57,57,57,47,120,104,116,109,108,34,62,60,97,32,116,97,114,103,101,116,
-61,34,95,98,108,97,110,107,34,32,116,101,120,116,47,104,116,109,108,59,32,99,104
-,97,114,115,101,116,61,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,
-34,62,60,116,97,98,108,101,32,99,101,108,108,112,97,100,100,105,110,103,61,34,97
-,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,116,101,120,
-116,45,97,108,105,103,110,58,32,99,101,110,116,101,114,59,116,111,32,108,97,115,
-116,32,118,101,114,115,105,111,110,32,98,121,32,98,97,99,107,103,114,111,117,110
-,100,45,99,111,108,111,114,58,32,35,34,32,104,114,101,102,61,34,104,116,116,112,
-58,47,47,119,119,119,46,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,32
-,105,100,61,60,97,32,104,114,101,102,61,34,35,34,32,99,108,97,115,115,61,34,34,
-62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,99,114,105,112,
-116,34,32,115,114,99,61,34,104,116,116,112,58,47,47,10,60,115,99,114,105,112,116
-,32,108,97,110,103,117,97,103,101,61,34,47,47,69,78,34,32,34,104,116,116,112,58,
-47,47,119,119,119,46,119,101,110,99,111,100,101,85,82,73,67,111,109,112,111,110,
-101,110,116,40,34,32,104,114,101,102,61,34,106,97,118,97,115,99,114,105,112,116,
-58,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,116,101,110,116,100,111,
-99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,115,99,112,111,115,105,
-116,105,111,110,58,32,97,98,115,111,108,117,116,101,59,115,99,114,105,112,116,32
-,115,114,99,61,34,104,116,116,112,58,47,47,32,115,116,121,108,101,61,34,109,97,
-114,103,105,110,45,116,111,112,58,46,109,105,110,46,106,115,34,62,60,47,115,99,
-114,105,112,116,62,10,60,47,100,105,118,62,10,60,100,105,118,32,99,108,97,115,
-115,61,34,119,51,46,111,114,103,47,49,57,57,57,47,120,104,116,109,108,34,32,10,
-13,10,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,62,100,105,115,116,105
-,110,99,116,105,111,110,32,98,101,116,119,101,101,110,47,34,32,116,97,114,103,
-101,116,61,34,95,98,108,97,110,107,34,62,60,108,105,110,107,32,104,114,101,102,
-61,34,104,116,116,112,58,47,47,101,110,99,111,100,105,110,103,61,34,117,116,102,
-45,56,34,63,62,10,119,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,
-101,114,63,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,119,119,119,46,
-105,99,111,110,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,32,115,116,
-121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,58,116,121,112,101,61,34,
-116,101,120,116,47,99,115,115,34,32,47,62,10,109,101,116,97,32,112,114,111,112,
-101,114,116,121,61,34,111,103,58,116,60,105,110,112,117,116,32,116,121,112,101,
-61,34,116,101,120,116,34,32,32,115,116,121,108,101,61,34,116,101,120,116,45,97,
-108,105,103,110,58,116,104,101,32,100,101,118,101,108,111,112,109,101,110,116,32
-,111,102,32,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
-101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,105,115
-,32,99,111,110,115,105,100,101,114,101,100,32,116,111,32,98,101,116,97,98,108,
-101,32,119,105,100,116,104,61,34,49,48,48,37,34,32,73,110,32,97,100,100,105,116,
-105,111,110,32,116,111,32,116,104,101,32,99,111,110,116,114,105,98,117,116,101,
-100,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,115,32,
-98,101,116,119,101,101,110,100,101,118,101,108,111,112,109,101,110,116,32,111,
-102,32,116,104,101,32,73,116,32,105,115,32,105,109,112,111,114,116,97,110,116,32
-,116,111,32,60,47,115,99,114,105,112,116,62,10,10,60,115,99,114,105,112,116,32,
-32,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,49,62,60,47,
-115,112,97,110,62,60,115,112,97,110,32,105,100,61,103,98,76,105,98,114,97,114,
-121,32,111,102,32,67,111,110,103,114,101,115,115,60,105,109,103,32,115,114,99,61
-,34,104,116,116,112,58,47,47,105,109,69,110,103,108,105,115,104,32,116,114,97,
-110,115,108,97,116,105,111,110,65,99,97,100,101,109,121,32,111,102,32,83,99,105,
-101,110,99,101,115,100,105,118,32,115,116,121,108,101,61,34,100,105,115,112,108,
-97,121,58,99,111,110,115,116,114,117,99,116,105,111,110,32,111,102,32,116,104,
-101,46,103,101,116,69,108,101,109,101,110,116,66,121,73,100,40,105,100,41,105,
-110,32,99,111,110,106,117,110,99,116,105,111,110,32,119,105,116,104,69,108,101,
-109,101,110,116,40,39,115,99,114,105,112,116,39,41,59,32,60,109,101,116,97,32,
-112,114,111,112,101,114,116,121,61,34,111,103,58,208,145,209,138,208,187,208,179
-,208,176,209,128,209,129,208,186,208,184,10,32,116,121,112,101,61,34,116,101,120
-,116,34,32,110,97,109,101,61,34,62,80,114,105,118,97,99,121,32,80,111,108,105,99
-,121,60,47,97,62,97,100,109,105,110,105,115,116,101,114,101,100,32,98,121,32,116
-,104,101,101,110,97,98,108,101,83,105,110,103,108,101,82,101,113,117,101,115,116
-,115,116,121,108,101,61,38,113,117,111,116,59,109,97,114,103,105,110,58,60,47,
-100,105,118,62,60,47,100,105,118,62,60,47,100,105,118,62,60,62,60,105,109,103,32
-,115,114,99,61,34,104,116,116,112,58,47,47,105,32,115,116,121,108,101,61,38,113,
-117,111,116,59,102,108,111,97,116,58,114,101,102,101,114,114,101,100,32,116,111,
-32,97,115,32,116,104,101,32,116,111,116,97,108,32,112,111,112,117,108,97,116,105
-,111,110,32,111,102,105,110,32,87,97,115,104,105,110,103,116,111,110,44,32,68,46
-,67,46,32,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45,97,
-109,111,110,103,32,111,116,104,101,114,32,116,104,105,110,103,115,44,111,114,103
-,97,110,105,122,97,116,105,111,110,32,111,102,32,116,104,101,112,97,114,116,105,
-99,105,112,97,116,101,100,32,105,110,32,116,104,101,116,104,101,32,105,110,116,
-114,111,100,117,99,116,105,111,110,32,111,102,105,100,101,110,116,105,102,105,
-101,100,32,119,105,116,104,32,116,104,101,102,105,99,116,105,111,110,97,108,32,
-99,104,97,114,97,99,116,101,114,32,79,120,102,111,114,100,32,85,110,105,118,101,
-114,115,105,116,121,32,109,105,115,117,110,100,101,114,115,116,97,110,100,105,
-110,103,32,111,102,84,104,101,114,101,32,97,114,101,44,32,104,111,119,101,118,
-101,114,44,115,116,121,108,101,115,104,101,101,116,34,32,104,114,101,102,61,34,
-47,67,111,108,117,109,98,105,97,32,85,110,105,118,101,114,115,105,116,121,101,
-120,112,97,110,100,101,100,32,116,111,32,105,110,99,108,117,100,101,117,115,117,
-97,108,108,121,32,114,101,102,101,114,114,101,100,32,116,111,105,110,100,105,99,
-97,116,105,110,103,32,116,104,97,116,32,116,104,101,104,97,118,101,32,115,117,
-103,103,101,115,116,101,100,32,116,104,97,116,97,102,102,105,108,105,97,116,101,
-100,32,119,105,116,104,32,116,104,101,99,111,114,114,101,108,97,116,105,111,110,
-32,98,101,116,119,101,101,110,110,117,109,98,101,114,32,111,102,32,100,105,102,
-102,101,114,101,110,116,62,60,47,116,100,62,60,47,116,114,62,60,47,116,97,98,108
-,101,62,82,101,112,117,98,108,105,99,32,111,102,32,73,114,101,108,97,110,100,10,
-60,47,115,99,114,105,112,116,62,10,60,115,99,114,105,112,116,32,117,110,100,101,
-114,32,116,104,101,32,105,110,102,108,117,101,110,99,101,99,111,110,116,114,105,
-98,117,116,105,111,110,32,116,111,32,116,104,101,79,102,102,105,99,105,97,108,32
-,119,101,98,115,105,116,101,32,111,102,104,101,97,100,113,117,97,114,116,101,114
-,115,32,111,102,32,116,104,101,99,101,110,116,101,114,101,100,32,97,114,111,117,
-110,100,32,116,104,101,105,109,112,108,105,99,97,116,105,111,110,115,32,111,102,
-32,116,104,101,104,97,118,101,32,98,101,101,110,32,100,101,118,101,108,111,112,
-101,100,70,101,100,101,114,97,108,32,82,101,112,117,98,108,105,99,32,111,102,98,
-101,99,97,109,101,32,105,110,99,114,101,97,115,105,110,103,108,121,99,111,110,
-116,105,110,117,97,116,105,111,110,32,111,102,32,116,104,101,78,111,116,101,44,
-32,104,111,119,101,118,101,114,44,32,116,104,97,116,115,105,109,105,108,97,114,
-32,116,111,32,116,104,97,116,32,111,102,32,99,97,112,97,98,105,108,105,116,105,
-101,115,32,111,102,32,116,104,101,97,99,99,111,114,100,97,110,99,101,32,119,105,
-116,104,32,116,104,101,112,97,114,116,105,99,105,112,97,110,116,115,32,105,110,
-32,116,104,101,102,117,114,116,104,101,114,32,100,101,118,101,108,111,112,109,
-101,110,116,117,110,100,101,114,32,116,104,101,32,100,105,114,101,99,116,105,111
-,110,105,115,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,101,100,
-104,105,115,32,121,111,117,110,103,101,114,32,98,114,111,116,104,101,114,60,47,
-116,100,62,60,47,116,114,62,60,47,116,97,98,108,101,62,60,97,32,104,116,116,112,
-45,101,113,117,105,118,61,34,88,45,85,65,45,112,104,121,115,105,99,97,108,32,112
-,114,111,112,101,114,116,105,101,115,111,102,32,66,114,105,116,105,115,104,32,67
-,111,108,117,109,98,105,97,104,97,115,32,98,101,101,110,32,99,114,105,116,105,99
-,105,122,101,100,40,119,105,116,104,32,116,104,101,32,101,120,99,101,112,116,105
-,111,110,113,117,101,115,116,105,111,110,115,32,97,98,111,117,116,32,116,104,101
-,112,97,115,115,105,110,103,32,116,104,114,111,117,103,104,32,116,104,101,48,34,
-32,99,101,108,108,112,97,100,100,105,110,103,61,34,48,34,32,116,104,111,117,115,
-97,110,100,115,32,111,102,32,112,101,111,112,108,101,114,101,100,105,114,101,99,
-116,115,32,104,101,114,101,46,32,70,111,114,104,97,118,101,32,99,104,105,108,100
-,114,101,110,32,117,110,100,101,114,37,51,69,37,51,67,47,115,99,114,105,112,116,
-37,51,69,34,41,41,59,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119
-,119,119,46,60,108,105,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,
-47,115,105,116,101,95,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,116,
-101,120,116,45,100,101,99,111,114,97,116,105,111,110,58,110,111,110,101,115,116,
-121,108,101,61,34,100,105,115,112,108,97,121,58,32,110,111,110,101,60,109,101,
-116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,88,45,110,101,119,32,68,
-97,116,101,40,41,46,103,101,116,84,105,109,101,40,41,32,116,121,112,101,61,34,
-105,109,97,103,101,47,120,45,105,99,111,110,34,60,47,115,112,97,110,62,60,115,
-112,97,110,32,99,108,97,115,115,61,34,108,97,110,103,117,97,103,101,61,34,106,97
-,118,97,115,99,114,105,112,116,119,105,110,100,111,119,46,108,111,99,97,116,105,
-111,110,46,104,114,101,102,60,97,32,104,114,101,102,61,34,106,97,118,97,115,99,
-114,105,112,116,58,45,45,62,13,10,60,115,99,114,105,112,116,32,116,121,112,101,
-61,34,116,60,97,32,104,114,101,102,61,39,104,116,116,112,58,47,47,119,119,119,46
-,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,114,101,102,61,34,60,47,
-100,105,118,62,13,10,60,100,105,118,32,99,108,97,115,115,61,34,60,115,99,114,105
-,112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,34,32,114,101,108,61,34,
-115,116,121,108,101,115,104,101,101,116,34,32,116,60,47,100,105,118,62,10,60,115
-,99,114,105,112,116,32,116,121,112,101,61,47,97,62,32,60,97,32,104,114,101,102,
-61,34,104,116,116,112,58,47,47,32,97,108,108,111,119,84,114,97,110,115,112,97,
-114,101,110,99,121,61,34,88,45,85,65,45,67,111,109,112,97,116,105,98,108,101,34,
-32,99,111,110,114,101,108,97,116,105,111,110,115,104,105,112,32,98,101,116,119,
-101,101,110,10,60,47,115,99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,
-32,60,47,97,62,60,47,108,105,62,60,47,117,108,62,60,47,100,105,118,62,97,115,115
-,111,99,105,97,116,101,100,32,119,105,116,104,32,116,104,101,32,112,114,111,103,
-114,97,109,109,105,110,103,32,108,97,110,103,117,97,103,101,60,47,97,62,60,97,32
-,104,114,101,102,61,34,104,116,116,112,58,47,47,60,47,97,62,60,47,108,105,62,60,
-108,105,32,99,108,97,115,115,61,34,102,111,114,109,32,97,99,116,105,111,110,61,
-34,104,116,116,112,58,47,47,60,100,105,118,32,115,116,121,108,101,61,34,100,105,
-115,112,108,97,121,58,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101
-,61,34,113,34,60,116,97,98,108,101,32,119,105,100,116,104,61,34,49,48,48,37,34,
-32,98,97,99,107,103,114,111,117,110,100,45,112,111,115,105,116,105,111,110,58,34
-,32,98,111,114,100,101,114,61,34,48,34,32,119,105,100,116,104,61,34,114,101,108,
-61,34,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,54,62,60,117,
-108,62,60,108,105,62,60,97,32,104,114,101,102,61,34,32,32,60,109,101,116,97,32,
-104,116,116,112,45,101,113,117,105,118,61,34,99,115,115,34,32,109,101,100,105,97
-,61,34,115,99,114,101,101,110,34,32,114,101,115,112,111,110,115,105,98,108,101,
-32,102,111,114,32,116,104,101,32,34,32,116,121,112,101,61,34,97,112,112,108,105,
-99,97,116,105,111,110,47,34,32,115,116,121,108,101,61,34,98,97,99,107,103,114,
-111,117,110,100,45,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,
-102,45,56,34,32,97,108,108,111,119,116,114,97,110,115,112,97,114,101,110,99,121,
-61,34,115,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
-101,13,10,60,109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,62,
-60,47,115,112,97,110,62,60,115,112,97,110,32,99,108,97,115,115,61,34,48,34,32,99
-,101,108,108,115,112,97,99,105,110,103,61,34,48,34,62,59,10,60,47,115,99,114,105
-,112,116,62,10,60,115,99,114,105,112,116,32,115,111,109,101,116,105,109,101,115,
-32,99,97,108,108,101,100,32,116,104,101,100,111,101,115,32,110,111,116,32,110,
-101,99,101,115,115,97,114,105,108,121,70,111,114,32,109,111,114,101,32,105,110,
-102,111,114,109,97,116,105,111,110,97,116,32,116,104,101,32,98,101,103,105,110,
-110,105,110,103,32,111,102,32,60,33,68,79,67,84,89,80,69,32,104,116,109,108,62,
-60,104,116,109,108,112,97,114,116,105,99,117,108,97,114,108,121,32,105,110,32,
-116,104,101,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,97,109,
-101,61,34,106,97,118,97,115,99,114,105,112,116,58,118,111,105,100,40,48,41,59,34
-,101,102,102,101,99,116,105,118,101,110,101,115,115,32,111,102,32,116,104,101,32
-,97,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,103,101,
-110,101,114,97,108,108,121,32,99,111,110,115,105,100,101,114,101,100,62,60,105,
-110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,34,62,60,47,115,
-99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,116,104,114,111,117,103,
-104,111,117,116,32,116,104,101,32,119,111,114,108,100,99,111,109,109,111,110,32,
-109,105,115,99,111,110,99,101,112,116,105,111,110,97,115,115,111,99,105,97,116,
-105,111,110,32,119,105,116,104,32,116,104,101,60,47,100,105,118,62,10,60,47,100,
-105,118,62,10,60,100,105,118,32,99,100,117,114,105,110,103,32,104,105,115,32,108
-,105,102,101,116,105,109,101,44,99,111,114,114,101,115,112,111,110,100,105,110,
-103,32,116,111,32,116,104,101,116,121,112,101,61,34,105,109,97,103,101,47,120,45
-,105,99,111,110,34,32,97,110,32,105,110,99,114,101,97,115,105,110,103,32,110,117
-,109,98,101,114,100,105,112,108,111,109,97,116,105,99,32,114,101,108,97,116,105,
-111,110,115,97,114,101,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,
-101,100,109,101,116,97,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,
-32,60,105,110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,101,120
-,97,109,112,108,101,115,32,105,110,99,108,117,100,101,32,116,104,101,34,62,60,
-105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,105,112,97,114,116,105,
-99,105,112,97,116,105,111,110,32,105,110,32,116,104,101,116,104,101,32,101,115,
-116,97,98,108,105,115,104,109,101,110,116,32,111,102,10,60,47,100,105,118,62,10,
-60,100,105,118,32,99,108,97,115,115,61,34,38,97,109,112,59,110,98,115,112,59,38,
-97,109,112,59,110,98,115,112,59,116,111,32,100,101,116,101,114,109,105,110,101,
-32,119,104,101,116,104,101,114,113,117,105,116,101,32,100,105,102,102,101,114,
-101,110,116,32,102,114,111,109,109,97,114,107,101,100,32,116,104,101,32,98,101,
-103,105,110,110,105,110,103,100,105,115,116,97,110,99,101,32,98,101,116,119,101,
-101,110,32,116,104,101,99,111,110,116,114,105,98,117,116,105,111,110,115,32,116,
-111,32,116,104,101,99,111,110,102,108,105,99,116,32,98,101,116,119,101,101,110,
-32,116,104,101,119,105,100,101,108,121,32,99,111,110,115,105,100,101,114,101,100
-,32,116,111,119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,102,105,114,
-115,116,119,105,116,104,32,118,97,114,121,105,110,103,32,100,101,103,114,101,101
-,115,104,97,118,101,32,115,112,101,99,117,108,97,116,101,100,32,116,104,97,116,
-40,100,111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,112,
-97,114,116,105,99,105,112,97,116,105,110,103,32,105,110,32,116,104,101,111,114,
-105,103,105,110,97,108,108,121,32,100,101,118,101,108,111,112,101,100,101,116,97
-,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,32,116,121,112,101,
-61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,105,110,116,101,114,99,104,97
-,110,103,101,97,98,108,121,32,119,105,116,104,109,111,114,101,32,99,108,111,115,
-101,108,121,32,114,101,108,97,116,101,100,115,111,99,105,97,108,32,97,110,100,32
-,112,111,108,105,116,105,99,97,108,116,104,97,116,32,119,111,117,108,100,32,111,
-116,104,101,114,119,105,115,101,112,101,114,112,101,110,100,105,99,117,108,97,
-114,32,116,111,32,116,104,101,115,116,121,108,101,32,116,121,112,101,61,34,116,
-101,120,116,47,99,115,115,116,121,112,101,61,34,115,117,98,109,105,116,34,32,110
-,97,109,101,61,34,102,97,109,105,108,105,101,115,32,114,101,115,105,100,105,110,
-103,32,105,110,100,101,118,101,108,111,112,105,110,103,32,99,111,117,110,116,114
-,105,101,115,99,111,109,112,117,116,101,114,32,112,114,111,103,114,97,109,109,
-105,110,103,101,99,111,110,111,109,105,99,32,100,101,118,101,108,111,112,109,101
-,110,116,100,101,116,101,114,109,105,110,97,116,105,111,110,32,111,102,32,116,
-104,101,102,111,114,32,109,111,114,101,32,105,110,102,111,114,109,97,116,105,111
-,110,111,110,32,115,101,118,101,114,97,108,32,111,99,99,97,115,105,111,110,115,
-112,111,114,116,117,103,117,195,170,115,32,40,69,117,114,111,112,101,117,41,208,
-163,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,209,
-131,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,208,
-160,208,190,209,129,209,129,208,184,208,185,209,129,208,186,208,190,208,185,208,
-188,208,176,209,130,208,181,209,128,208,184,208,176,208,187,208,190,208,178,208,
-184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,208,184,209,
-131,208,191,209,128,208,176,208,178,208,187,208,181,208,189,208,184,209,143,208,
-189,208,181,208,190,208,177,209,133,208,190,208,180,208,184,208,188,208,190,208,
-184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
-152,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
-160,208,181,209,129,208,191,209,131,208,177,208,187,208,184,208,186,208,184,208,
-186,208,190,208,187,208,184,209,135,208,181,209,129,209,130,208,178,208,190,208,
-184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,142,209,
-130,208,181,209,128,209,128,208,184,209,130,208,190,209,128,208,184,208,184,208,
-180,208,190,209,129,209,130,208,176,209,130,208,190,209,135,208,189,208,190,216,
-167,217,132,217,133,216,170,217,136,216,167,216,172,216,175,217,136,217,134,216,
-167,217,132,216,167,216,180,216,170,216,177,216,167,217,131,216,167,216,170,216,
-167,217,132,216,167,217,130,216,170,216,177,216,167,216,173,216,167,216,170,104,
-116,109,108,59,32,99,104,97,114,115,101,116,61,85,84,70,45,56,34,32,115,101,116,
-84,105,109,101,111,117,116,40,102,117,110,99,116,105,111,110,40,41,100,105,115,
-112,108,97,121,58,105,110,108,105,110,101,45,98,108,111,99,107,59,60,105,110,112
-,117,116,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,116,121,112,101,
-32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,60,105,109,103,32,
-115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,46,34,32,34,104,116,116,
-112,58,47,47,119,119,119,46,119,51,46,111,114,103,47,115,104,111,114,116,99,117,
-116,32,105,99,111,110,34,32,104,114,101,102,61,34,34,32,97,117,116,111,99,111,
-109,112,108,101,116,101,61,34,111,102,102,34,32,60,47,97,62,60,47,100,105,118,62
-,60,100,105,118,32,99,108,97,115,115,61,60,47,97,62,60,47,108,105,62,10,60,108,
-105,32,99,108,97,115,115,61,34,99,115,115,34,32,116,121,112,101,61,34,116,101,
-120,116,47,99,115,115,34,32,60,102,111,114,109,32,97,99,116,105,111,110,61,34,
-104,116,116,112,58,47,47,120,116,47,99,115,115,34,32,104,114,101,102,61,34,104,
-116,116,112,58,47,47,108,105,110,107,32,114,101,108,61,34,97,108,116,101,114,110
-,97,116,101,34,32,13,10,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,
-101,120,116,47,32,111,110,99,108,105,99,107,61,34,106,97,118,97,115,99,114,105,
-112,116,58,40,110,101,119,32,68,97,116,101,41,46,103,101,116,84,105,109,101,40,
-41,125,104,101,105,103,104,116,61,34,49,34,32,119,105,100,116,104,61,34,49,34,32
-,80,101,111,112,108,101,39,115,32,82,101,112,117,98,108,105,99,32,111,102,32,32,
-60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,116,101,
-120,116,45,100,101,99,111,114,97,116,105,111,110,58,117,110,100,101,114,116,104,
-101,32,98,101,103,105,110,110,105,110,103,32,111,102,32,116,104,101,32,60,47,100
-,105,118,62,10,60,47,100,105,118,62,10,60,47,100,105,118,62,10,101,115,116,97,98
-,108,105,115,104,109,101,110,116,32,111,102,32,116,104,101,32,60,47,100,105,118,
-62,60,47,100,105,118,62,60,47,100,105,118,62,60,47,100,35,118,105,101,119,112,
-111,114,116,123,109,105,110,45,104,101,105,103,104,116,58,10,60,115,99,114,105,
-112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,111,112,116,105,111,110,62,
-60,111,112,116,105,111,110,32,118,97,108,117,101,61,111,102,116,101,110,32,114,
-101,102,101,114,114,101,100,32,116,111,32,97,115,32,47,111,112,116,105,111,110,
-62,10,60,111,112,116,105,111,110,32,118,97,108,117,60,33,68,79,67,84,89,80,69,32
-,104,116,109,108,62,10,60,33,45,45,91,73,110,116,101,114,110,97,116,105,111,110,
-97,108,32,65,105,114,112,111,114,116,62,10,60,97,32,104,114,101,102,61,34,104,
-116,116,112,58,47,47,119,119,119,60,47,97,62,60,97,32,104,114,101,102,61,34,104,
-116,116,112,58,47,47,119,224,184,160,224,184,178,224,184,169,224,184,178,224,185
-,132,224,184,151,224,184,162,225,131,165,225,131,144,225,131,160,225,131,151,225
-,131,163,225,131,154,225,131,152,230,173,163,233,171,148,228,184,173,230,150,135
-,32,40,231,185,129,233,171,148,41,224,164,168,224,164,191,224,164,176,224,165,
-141,224,164,166,224,165,135,224,164,182,224,164,161,224,164,190,224,164,137,224,
-164,168,224,164,178,224,165,139,224,164,161,224,164,149,224,165,141,224,164,183,
-224,165,135,224,164,164,224,165,141,224,164,176,224,164,156,224,164,190,224,164,
-168,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184,224,164,130,224,
-164,172,224,164,130,224,164,167,224,164,191,224,164,164,224,164,184,224,165,141,
-224,164,165,224,164,190,224,164,170,224,164,168,224,164,190,224,164,184,224,165,
-141,224,164,181,224,165,128,224,164,149,224,164,190,224,164,176,224,164,184,224,
-164,130,224,164,184,224,165,141,224,164,149,224,164,176,224,164,163,224,164,184,
-224,164,190,224,164,174,224,164,151,224,165,141,224,164,176,224,165,128,224,164,
-154,224,164,191,224,164,159,224,165,141,224,164,160,224,165,139,224,164,130,224,
-164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164,168,
-224,164,133,224,164,174,224,165,135,224,164,176,224,164,191,224,164,149,224,164,
-190,224,164,181,224,164,191,224,164,173,224,164,191,224,164,168,224,165,141,224,
-164,168,224,164,151,224,164,190,224,164,161,224,164,191,224,164,175,224,164,190,
-224,164,129,224,164,149,224,165,141,224,164,175,224,165,139,224,164,130,224,164,
-149,224,164,191,224,164,184,224,165,129,224,164,176,224,164,149,224,165,141,224,
-164,183,224,164,190,224,164,170,224,164,185,224,165,129,224,164,129,224,164,154,
-224,164,164,224,165,128,224,164,170,224,165,141,224,164,176,224,164,172,224,164,
-130,224,164,167,224,164,168,224,164,159,224,164,191,224,164,170,224,165,141,224,
-164,170,224,164,163,224,165,128,224,164,149,224,165,141,224,164,176,224,164,191,
-224,164,149,224,165,135,224,164,159,224,164,170,224,165,141,224,164,176,224,164,
-190,224,164,176,224,164,130,224,164,173,224,164,170,224,165,141,224,164,176,224,
-164,190,224,164,170,224,165,141,224,164,164,224,164,174,224,164,190,224,164,178,
-224,164,191,224,164,149,224,165,139,224,164,130,224,164,176,224,164,171,224,164,
-188,224,165,141,224,164,164,224,164,190,224,164,176,224,164,168,224,164,191,224,
-164,176,224,165,141,224,164,174,224,164,190,224,164,163,224,164,178,224,164,191,
-224,164,174,224,164,191,224,164,159,224,165,135,224,164,161,100,101,115,99,114,
-105,112,116,105,111,110,34,32,99,111,110,116,101,110,116,61,34,100,111,99,117,
-109,101,110,116,46,108,111,99,97,116,105,111,110,46,112,114,111,116,46,103,101,
-116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,60,33,68,79
-,67,84,89,80,69,32,104,116,109,108,62,10,60,104,116,109,108,32,60,109,101,116,97
-,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,58,117,114,108,34,32
-,99,111,110,116,101,110,116,61,34,104,116,116,112,58,47,47,46,99,115,115,34,32,
-114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,115,116,121,108,101
-,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,62,116,121,112,101,61
-,34,116,101,120,116,47,99,115,115,34,32,104,114,101,102,61,34,119,51,46,111,114,
-103,47,49,57,57,57,47,120,104,116,109,108,34,32,120,109,108,116,121,112,101,61,
-34,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,34,32,109,101,116,104
-,111,100,61,34,103,101,116,34,32,97,99,116,105,111,110,61,34,108,105,110,107,32,
-114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,32,61,32,100,111
-,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,116,121,112,
-101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,34,32,47,62,99,101,108,108
-,112,97,100,100,105,110,103,61,34,48,34,32,99,101,108,108,115,112,46,99,115,115,
-34,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,60,47,97,62,60,
-47,108,105,62,60,108,105,62,60,97,32,104,114,101,102,61,34,34,32,119,105,100,116
-,104,61,34,49,34,32,104,101,105,103,104,116,61,34,49,34,34,62,60,97,32,104,114,
-101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,115,116,121,108,101,61,34,
-100,105,115,112,108,97,121,58,110,111,110,101,59,34,62,97,108,116,101,114,110,97
-,116,101,34,32,116,121,112,101,61,34,97,112,112,108,105,45,47,47,87,51,67,47,47,
-68,84,68,32,88,72,84,77,76,32,49,46,48,32,101,108,108,115,112,97,99,105,110,103,
-61,34,48,34,32,99,101,108,108,112,97,100,32,116,121,112,101,61,34,104,105,100,
-100,101,110,34,32,118,97,108,117,101,61,34,47,97,62,38,110,98,115,112,59,60,115,
-112,97,110,32,114,111,108,101,61,34,115,10,60,105,110,112,117,116,32,116,121,112
-,101,61,34,104,105,100,100,101,110,34,32,108,97,110,103,117,97,103,101,61,34,74,
-97,118,97,83,99,114,105,112,116,34,32,32,100,111,99,117,109,101,110,116,46,103,
-101,116,69,108,101,109,101,110,116,115,66,103,61,34,48,34,32,99,101,108,108,115,
-112,97,99,105,110,103,61,34,48,34,32,121,112,101,61,34,116,101,120,116,47,99,115
-,115,34,32,109,101,100,105,97,61,34,116,121,112,101,61,39,116,101,120,116,47,106
-,97,118,97,115,99,114,105,112,116,39,119,105,116,104,32,116,104,101,32,101,120,
-99,101,112,116,105,111,110,32,111,102,32,121,112,101,61,34,116,101,120,116,47,99
-,115,115,34,32,114,101,108,61,34,115,116,32,104,101,105,103,104,116,61,34,49,34,
-32,119,105,100,116,104,61,34,49,34,32,61,39,43,101,110,99,111,100,101,85,82,73,
-67,111,109,112,111,110,101,110,116,40,60,108,105,110,107,32,114,101,108,61,34,97
-,108,116,101,114,110,97,116,101,34,32,10,98,111,100,121,44,32,116,114,44,32,105,
-110,112,117,116,44,32,116,101,120,116,109,101,116,97,32,110,97,109,101,61,34,114
-,111,98,111,116,115,34,32,99,111,110,109,101,116,104,111,100,61,34,112,111,115,
-116,34,32,97,99,116,105,111,110,61,34,62,10,60,97,32,104,114,101,102,61,34,104,
-116,116,112,58,47,47,119,119,119,46,99,115,115,34,32,114,101,108,61,34,115,116,
-121,108,101,115,104,101,101,116,34,32,60,47,100,105,118,62,60,47,100,105,118,62,
-60,100,105,118,32,99,108,97,115,115,108,97,110,103,117,97,103,101,61,34,106,97,
-118,97,115,99,114,105,112,116,34,62,97,114,105,97,45,104,105,100,100,101,110,61,
-34,116,114,117,101,34,62,194,183,60,114,105,112,116,34,32,116,121,112,101,61,34,
-116,101,120,116,47,106,97,118,97,115,108,61,48,59,125,41,40,41,59,10,40,102,117,
-110,99,116,105,111,110,40,41,123,98,97,99,107,103,114,111,117,110,100,45,105,109
-,97,103,101,58,32,117,114,108,40,47,97,62,60,47,108,105,62,60,108,105,62,60,97,
-32,104,114,101,102,61,34,104,9,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
-104,116,116,112,58,47,47,97,116,111,114,34,32,97,114,105,97,45,104,105,100,100,
-101,110,61,34,116,114,117,62,32,60,97,32,104,114,101,102,61,34,104,116,116,112,
-58,47,47,119,119,119,46,108,97,110,103,117,97,103,101,61,34,106,97,118,97,115,99
-,114,105,112,116,34,32,47,111,112,116,105,111,110,62,10,60,111,112,116,105,111,
-110,32,118,97,108,117,101,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,
-32,99,108,97,115,115,61,114,97,116,111,114,34,32,97,114,105,97,45,104,105,100,
-100,101,110,61,34,116,114,101,61,40,110,101,119,32,68,97,116,101,41,46,103,101,
-116,84,105,109,101,40,41,112,111,114,116,117,103,117,195,170,115,32,40,100,111,
-32,66,114,97,115,105,108,41,208,190,209,128,208,179,208,176,208,189,208,184,208,
-183,208,176,209,134,208,184,208,184,208,178,208,190,208,183,208,188,208,190,208,
-182,208,189,208,190,209,129,209,130,209,140,208,190,208,177,209,128,208,176,208,
-183,208,190,208,178,208,176,208,189,208,184,209,143,209,128,208,181,208,179,208,
-184,209,129,209,130,209,128,208,176,209,134,208,184,208,184,208,178,208,190,208,
-183,208,188,208,190,208,182,208,189,208,190,209,129,209,130,208,184,208,190,208,
-177,209,143,208,183,208,176,209,130,208,181,208,187,209,140,208,189,208,176,60,
-33,68,79,67,84,89,80,69,32,104,116,109,108,32,80,85,66,76,73,67,32,34,110,116,45
-,84,121,112,101,34,32,99,111,110,116,101,110,116,61,34,116,101,120,116,47,60,109
-,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,116,101,
-114,97,110,115,105,116,105,111,110,97,108,47,47,69,78,34,32,34,104,116,116,112,
-58,60,104,116,109,108,32,120,109,108,110,115,61,34,104,116,116,112,58,47,47,119,
-119,119,45,47,47,87,51,67,47,47,68,84,68,32,88,72,84,77,76,32,49,46,48,32,84,68,
-84,68,47,120,104,116,109,108,49,45,116,114,97,110,115,105,116,105,111,110,97,108
-,47,47,119,119,119,46,119,51,46,111,114,103,47,84,82,47,120,104,116,109,108,49,
-47,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,
-39,59,60,109,101,116,97,32,110,97,109,101,61,34,100,101,115,99,114,105,112,116,
-105,111,110,112,97,114,101,110,116,78,111,100,101,46,105,110,115,101,114,116,66,
-101,102,111,114,101,60,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,
-100,101,110,34,32,110,97,106,115,34,32,116,121,112,101,61,34,116,101,120,116,47,
-106,97,118,97,115,99,114,105,40,100,111,99,117,109,101,110,116,41,46,114,101,97,
-100,121,40,102,117,110,99,116,105,115,99,114,105,112,116,32,116,121,112,101,61,
-34,116,101,120,116,47,106,97,118,97,115,105,109,97,103,101,34,32,99,111,110,116,
-101,110,116,61,34,104,116,116,112,58,47,47,85,65,45,67,111,109,112,97,116,105,98
-,108,101,34,32,99,111,110,116,101,110,116,61,116,109,108,59,32,99,104,97,114,115
-,101,116,61,117,116,102,45,56,34,32,47,62,10,108,105,110,107,32,114,101,108,61,
-34,115,104,111,114,116,99,117,116,32,105,99,111,110,60,108,105,110,107,32,114,
-101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,60,47,115,99,114,105
-,112,116,62,10,60,115,99,114,105,112,116,32,116,121,112,101,61,61,32,100,111,99,
-117,109,101,110,116,46,99,114,101,97,116,101,69,108,101,109,101,110,60,97,32,116
-,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,104,114,101,102,61,32,100,
-111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,115,66,105,
-110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61
-,97,46,116,121,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,
-105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,
-97,109,101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,
-34,32,47,62,100,116,100,34,62,10,60,104,116,109,108,32,120,109,108,110,115,61,34
-,104,116,116,112,45,47,47,87,51,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,
-32,84,101,110,116,115,66,121,84,97,103,78,97,109,101,40,39,115,99,114,105,112,
-116,39,41,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,
-34,32,110,97,109,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,101,120,
-116,47,106,97,118,97,115,34,32,115,116,121,108,101,61,34,100,105,115,112,108,97,
-121,58,110,111,110,101,59,34,62,100,111,99,117,109,101,110,116,46,103,101,116,69
-,108,101,109,101,110,116,66,121,73,100,40,61,100,111,99,117,109,101,110,116,46,
-99,114,101,97,116,101,69,108,101,109,101,110,116,40,39,32,116,121,112,101,61,39,
-116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,105,110,112,117,116,
-32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61,34,100,46,103,
-101,116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,115,110
-,105,99,97,108,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,
-46,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,32,84,114,97,110,115,105,116,
-60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34
-,62,10,10,60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,
-115,115,34,62,105,111,110,97,108,46,100,116,100,34,62,10,60,104,116,109,108,32,
-120,109,108,110,115,61,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,
-116,101,110,116,45,84,121,112,101,100,105,110,103,61,34,48,34,32,99,101,108,108,
-115,112,97,99,105,110,103,61,34,48,34,104,116,109,108,59,32,99,104,97,114,115,
-101,116,61,117,116,102,45,56,34,32,47,62,10,32,115,116,121,108,101,61,34,100,105
-,115,112,108,97,121,58,110,111,110,101,59,34,62,60,60,108,105,62,60,97,32,104,
-114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,32,116,121,112,101,61,
-39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,62,208,180,208,181
-,209,143,209,130,208,181,208,187,209,140,208,189,208,190,209,129,209,130,208,184
-,209,129,208,190,208,190,209,130,208,178,208,181,209,130,209,129,209,130,208,178
-,208,184,208,184,208,191,209,128,208,190,208,184,208,183,208,178,208,190,208,180
-,209,129,209,130,208,178,208,176,208,177,208,181,208,183,208,190,208,191,208,176
-,209,129,208,189,208,190,209,129,209,130,208,184,224,164,170,224,165,129,224,164
-,184,224,165,141,224,164,164,224,164,191,224,164,149,224,164,190,224,164,149,224
-,164,190,224,164,130,224,164,151,224,165,141,224,164,176,224,165,135,224,164,184
-,224,164,137,224,164,168,224,165,141,224,164,185,224,165,139,224,164,130,224,164
-,168,224,165,135,224,164,181,224,164,191,224,164,167,224,164,190,224,164,168,224
-,164,184,224,164,173,224,164,190,224,164,171,224,164,191,224,164,149,224,165,141
-,224,164,184,224,164,191,224,164,130,224,164,151,224,164,184,224,165,129,224,164
-,176,224,164,149,224,165,141,224,164,183,224,164,191,224,164,164,224,164,149,224
-,165,137,224,164,170,224,165,128,224,164,176,224,164,190,224,164,135,224,164,159
-,224,164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164
-,170,224,164,168,224,164,149,224,164,190,224,164,176,224,165,141,224,164,176,224
-,164,181,224,164,190,224,164,136,224,164,184,224,164,149,224,165,141,224,164,176
-,224,164,191,224,164,175,224,164,164,224,164,190
-}
-;
-#endif  /* !BROTLI_EXTERNAL_DICTIONARY_DATA */
-
-static BrotliDictionary kBrotliDictionary = {
-  /* size_bits_by_length */
-  {
-    0, 0, 0, 0, 10, 10, 11, 11,
-    10, 10, 10, 10, 10, 9, 9, 8,
-    7, 7, 8, 7, 7, 6, 6, 5,
-    5, 0, 0, 0, 0, 0, 0, 0
-  },
-
-  /* offsets_by_length */
-  {
-    0, 0, 0, 0, 0, 4096, 9216, 21504,
-    35840, 44032, 53248, 63488, 74752, 87040, 93696, 100864,
-    104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280,
-    122016, 122784, 122784, 122784, 122784, 122784, 122784, 122784
-  },
-
-  /* data_size ==  sizeof(kBrotliDictionaryData) */
-  122784,
-
-  /* data */
-#ifdef BROTLI_EXTERNAL_DICTIONARY_DATA
-  NULL
-#else
-  kBrotliDictionaryData
-#endif
-};
-
-const BrotliDictionary* BrotliGetDictionary() {
-  return &kBrotliDictionary;
-}
-
-void BrotliSetDictionaryData(const uint8_t* data) {
-  if (!!data && !kBrotliDictionary.data) {
-    kBrotliDictionary.data = data;
-  }
-}
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
diff --git a/Source/ThirdParty/brotli/common/dictionary.h b/Source/ThirdParty/brotli/common/dictionary.h
deleted file mode 100644 (file)
index 46fe533..0000000
+++ /dev/null
@@ -1,64 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Collection of static dictionary words. */
-
-#ifndef BROTLI_COMMON_DICTIONARY_H_
-#define BROTLI_COMMON_DICTIONARY_H_
-
-#include <brotli/port.h>
-#include <brotli/types.h>
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-typedef struct BrotliDictionary {
-  /**
-   * Number of bits to encode index of dictionary word in a bucket.
-   *
-   * Specification: Appendix A. Static Dictionary Data
-   *
-   * Words in a dictionary are bucketed by length.
-   * @c 0 means that there are no words of a given length.
-   * Dictionary consists of words with length of [4..24] bytes.
-   * Values at [0..3] and [25..31] indices should not be addressed.
-   */
-  const uint8_t size_bits_by_length[32];
-
-  /* assert(offset[i + 1] == offset[i] + (bits[i] ? (i << bits[i]) : 0)) */
-  const uint32_t offsets_by_length[32];
-
-  /* assert(data_size == offsets_by_length[31]) */
-  const size_t data_size;
-
-  /* Data array is not bound, and should obey to size_bits_by_length values.
-     Specified size matches default (RFC 7932) dictionary. Its size is
-     defined by data_size */
-  const uint8_t* data;
-} BrotliDictionary;
-
-BROTLI_COMMON_API extern const BrotliDictionary* BrotliGetDictionary(void);
-
-/**
- * Sets dictionary data.
- *
- * When dictionary data is already set / present, this method is no-op.
- *
- * Dictionary data MUST be provided before BrotliGetDictionary is invoked.
- * This method is used ONLY in multi-client environment (e.g. C + Java),
- * to reduce storage by sharing single dictionary between implementations.
- */
-BROTLI_COMMON_API void BrotliSetDictionaryData(const uint8_t* data);
-
-#define BROTLI_MIN_DICTIONARY_WORD_LENGTH 4
-#define BROTLI_MAX_DICTIONARY_WORD_LENGTH 24
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
-
-#endif  /* BROTLI_COMMON_DICTIONARY_H_ */
diff --git a/Source/ThirdParty/brotli/common/version.h b/Source/ThirdParty/brotli/common/version.h
deleted file mode 100755 (executable)
index c63f685..0000000
+++ /dev/null
@@ -1,19 +0,0 @@
-/* Copyright 2016 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Version definition. */
-
-#ifndef BROTLI_COMMON_VERSION_H_
-#define BROTLI_COMMON_VERSION_H_
-
-/* This macro should only be used when library is compiled together with client.
-   If library is dynamically linked, use BrotliDecoderVersion and
-   BrotliEncoderVersion methods. */
-
-/* Semantic version, calculated as (MAJOR << 24) | (MINOR << 12) | PATCH */
-#define BROTLI_VERSION 0x1000001
-
-#endif  /* BROTLI_COMMON_VERSION_H_ */
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.c b/Source/ThirdParty/brotli/dec/bit_reader.c
deleted file mode 100644 (file)
index 9925ba4..0000000
+++ /dev/null
@@ -1,48 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Bit reading helpers */
-
-#include "./bit_reader.h"
-
-#include <brotli/types.h>
-#include "./port.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-void BrotliInitBitReader(BrotliBitReader* const br) {
-  br->val_ = 0;
-  br->bit_pos_ = sizeof(br->val_) << 3;
-}
-
-BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br) {
-  size_t aligned_read_mask = (sizeof(br->val_) >> 1) - 1;
-  /* Fixing alignment after unaligned BrotliFillWindow would result accumulator
-     overflow. If unalignment is caused by BrotliSafeReadBits, then there is
-     enough space in accumulator to fix alignment. */
-  if (!BROTLI_ALIGNED_READ) {
-    aligned_read_mask = 0;
-  }
-  if (BrotliGetAvailableBits(br) == 0) {
-    if (!BrotliPullByte(br)) {
-      return BROTLI_FALSE;
-    }
-  }
-
-  while ((((size_t)br->next_in) & aligned_read_mask) != 0) {
-    if (!BrotliPullByte(br)) {
-      /* If we consumed all the input, we don't care about the alignment. */
-      return BROTLI_TRUE;
-    }
-  }
-  return BROTLI_TRUE;
-}
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.h b/Source/ThirdParty/brotli/dec/bit_reader.h
deleted file mode 100644 (file)
index 30e6761..0000000
+++ /dev/null
@@ -1,360 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Bit reading helpers */
-
-#ifndef BROTLI_DEC_BIT_READER_H_
-#define BROTLI_DEC_BIT_READER_H_
-
-#include <string.h>  /* memcpy */
-
-#include <brotli/types.h>
-#include "./port.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-#define BROTLI_SHORT_FILL_BIT_WINDOW_READ (sizeof(reg_t) >> 1)
-
-static const uint32_t kBitMask[33] = { 0x0000,
-    0x00000001, 0x00000003, 0x00000007, 0x0000000F,
-    0x0000001F, 0x0000003F, 0x0000007F, 0x000000FF,
-    0x000001FF, 0x000003FF, 0x000007FF, 0x00000FFF,
-    0x00001FFF, 0x00003FFF, 0x00007FFF, 0x0000FFFF,
-    0x0001FFFF, 0x0003FFFF, 0x0007FFFF, 0x000FFFFF,
-    0x001FFFFF, 0x003FFFFF, 0x007FFFFF, 0x00FFFFFF,
-    0x01FFFFFF, 0x03FFFFFF, 0x07FFFFFF, 0x0FFFFFFF,
-    0x1FFFFFFF, 0x3FFFFFFF, 0x7FFFFFFF, 0xFFFFFFFF
-};
-
-static BROTLI_INLINE uint32_t BitMask(uint32_t n) {
-  if (IS_CONSTANT(n) || BROTLI_HAS_UBFX) {
-    /* Masking with this expression turns to a single
-       "Unsigned Bit Field Extract" UBFX instruction on ARM. */
-    return ~((0xffffffffU) << n);
-  } else {
-    return kBitMask[n];
-  }
-}
-
-typedef struct {
-  reg_t val_;              /* pre-fetched bits */
-  uint32_t bit_pos_;       /* current bit-reading position in val_ */
-  const uint8_t* next_in;  /* the byte we're reading from */
-  size_t avail_in;
-} BrotliBitReader;
-
-typedef struct {
-  reg_t val_;
-  uint32_t bit_pos_;
-  const uint8_t* next_in;
-  size_t avail_in;
-} BrotliBitReaderState;
-
-/* Initializes the BrotliBitReader fields. */
-BROTLI_INTERNAL void BrotliInitBitReader(BrotliBitReader* const br);
-
-/* Ensures that accumulator is not empty. May consume one byte of input.
-   Returns 0 if data is required but there is no input available.
-   For BROTLI_ALIGNED_READ this function also prepares bit reader for aligned
-   reading. */
-BROTLI_INTERNAL BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br);
-
-static BROTLI_INLINE void BrotliBitReaderSaveState(
-    BrotliBitReader* const from, BrotliBitReaderState* to) {
-  to->val_ = from->val_;
-  to->bit_pos_ = from->bit_pos_;
-  to->next_in = from->next_in;
-  to->avail_in = from->avail_in;
-}
-
-static BROTLI_INLINE void BrotliBitReaderRestoreState(
-    BrotliBitReader* const to, BrotliBitReaderState* from) {
-  to->val_ = from->val_;
-  to->bit_pos_ = from->bit_pos_;
-  to->next_in = from->next_in;
-  to->avail_in = from->avail_in;
-}
-
-static BROTLI_INLINE uint32_t BrotliGetAvailableBits(
-    const BrotliBitReader* br) {
-  return (BROTLI_64_BITS ? 64 : 32) - br->bit_pos_;
-}
-
-/* Returns amount of unread bytes the bit reader still has buffered from the
-   BrotliInput, including whole bytes in br->val_. */
-static BROTLI_INLINE size_t BrotliGetRemainingBytes(BrotliBitReader* br) {
-  return br->avail_in + (BrotliGetAvailableBits(br) >> 3);
-}
-
-/* Checks if there is at least |num| bytes left in the input ring-buffer
-   (excluding the bits remaining in br->val_). */
-static BROTLI_INLINE BROTLI_BOOL BrotliCheckInputAmount(
-    BrotliBitReader* const br, size_t num) {
-  return TO_BROTLI_BOOL(br->avail_in >= num);
-}
-
-static BROTLI_INLINE uint16_t BrotliLoad16LE(const uint8_t* in) {
-  if (BROTLI_LITTLE_ENDIAN) {
-    return *((const uint16_t*)in);
-  } else if (BROTLI_BIG_ENDIAN) {
-    uint16_t value = *((const uint16_t*)in);
-    return (uint16_t)(((value & 0xFFU) << 8) | ((value & 0xFF00U) >> 8));
-  } else {
-    return (uint16_t)(in[0] | (in[1] << 8));
-  }
-}
-
-static BROTLI_INLINE uint32_t BrotliLoad32LE(const uint8_t* in) {
-  if (BROTLI_LITTLE_ENDIAN) {
-    return *((const uint32_t*)in);
-  } else if (BROTLI_BIG_ENDIAN) {
-    uint32_t value = *((const uint32_t*)in);
-    return ((value & 0xFFU) << 24) | ((value & 0xFF00U) << 8) |
-        ((value & 0xFF0000U) >> 8) | ((value & 0xFF000000U) >> 24);
-  } else {
-    uint32_t value = (uint32_t)(*(in++));
-    value |= (uint32_t)(*(in++)) << 8;
-    value |= (uint32_t)(*(in++)) << 16;
-    value |= (uint32_t)(*(in++)) << 24;
-    return value;
-  }
-}
-
-#if (BROTLI_64_BITS)
-static BROTLI_INLINE uint64_t BrotliLoad64LE(const uint8_t* in) {
-  if (BROTLI_LITTLE_ENDIAN) {
-    return *((const uint64_t*)in);
-  } else if (BROTLI_BIG_ENDIAN) {
-    uint64_t value = *((const uint64_t*)in);
-    return
-        ((value & 0xFFU) << 56) |
-        ((value & 0xFF00U) << 40) |
-        ((value & 0xFF0000U) << 24) |
-        ((value & 0xFF000000U) << 8) |
-        ((value & 0xFF00000000U) >> 8) |
-        ((value & 0xFF0000000000U) >> 24) |
-        ((value & 0xFF000000000000U) >> 40) |
-        ((value & 0xFF00000000000000U) >> 56);
-  } else {
-    uint64_t value = (uint64_t)(*(in++));
-    value |= (uint64_t)(*(in++)) << 8;
-    value |= (uint64_t)(*(in++)) << 16;
-    value |= (uint64_t)(*(in++)) << 24;
-    value |= (uint64_t)(*(in++)) << 32;
-    value |= (uint64_t)(*(in++)) << 40;
-    value |= (uint64_t)(*(in++)) << 48;
-    value |= (uint64_t)(*(in++)) << 56;
-    return value;
-  }
-}
-#endif
-
-/* Guarantees that there are at least n_bits + 1 bits in accumulator.
-   Precondition: accumulator contains at least 1 bit.
-   n_bits should be in the range [1..24] for regular build. For portable
-   non-64-bit little-endian build only 16 bits are safe to request. */
-static BROTLI_INLINE void BrotliFillBitWindow(
-    BrotliBitReader* const br, uint32_t n_bits) {
-#if (BROTLI_64_BITS)
-  if (!BROTLI_ALIGNED_READ && IS_CONSTANT(n_bits) && (n_bits <= 8)) {
-    if (br->bit_pos_ >= 56) {
-      br->val_ >>= 56;
-      br->bit_pos_ ^= 56;  /* here same as -= 56 because of the if condition */
-      br->val_ |= BrotliLoad64LE(br->next_in) << 8;
-      br->avail_in -= 7;
-      br->next_in += 7;
-    }
-  } else if (!BROTLI_ALIGNED_READ && IS_CONSTANT(n_bits) && (n_bits <= 16)) {
-    if (br->bit_pos_ >= 48) {
-      br->val_ >>= 48;
-      br->bit_pos_ ^= 48;  /* here same as -= 48 because of the if condition */
-      br->val_ |= BrotliLoad64LE(br->next_in) << 16;
-      br->avail_in -= 6;
-      br->next_in += 6;
-    }
-  } else {
-    if (br->bit_pos_ >= 32) {
-      br->val_ >>= 32;
-      br->bit_pos_ ^= 32;  /* here same as -= 32 because of the if condition */
-      br->val_ |= ((uint64_t)BrotliLoad32LE(br->next_in)) << 32;
-      br->avail_in -= BROTLI_SHORT_FILL_BIT_WINDOW_READ;
-      br->next_in += BROTLI_SHORT_FILL_BIT_WINDOW_READ;
-    }
-  }
-#else
-  if (!BROTLI_ALIGNED_READ && IS_CONSTANT(n_bits) && (n_bits <= 8)) {
-    if (br->bit_pos_ >= 24) {
-      br->val_ >>= 24;
-      br->bit_pos_ ^= 24;  /* here same as -= 24 because of the if condition */
-      br->val_ |= BrotliLoad32LE(br->next_in) << 8;
-      br->avail_in -= 3;
-      br->next_in += 3;
-    }
-  } else {
-    if (br->bit_pos_ >= 16) {
-      br->val_ >>= 16;
-      br->bit_pos_ ^= 16;  /* here same as -= 16 because of the if condition */
-      br->val_ |= ((uint32_t)BrotliLoad16LE(br->next_in)) << 16;
-      br->avail_in -= BROTLI_SHORT_FILL_BIT_WINDOW_READ;
-      br->next_in += BROTLI_SHORT_FILL_BIT_WINDOW_READ;
-    }
-  }
-#endif
-}
-
-/* Mostly like BrotliFillBitWindow, but guarantees only 16 bits and reads no
-   more than BROTLI_SHORT_FILL_BIT_WINDOW_READ bytes of input. */
-static BROTLI_INLINE void BrotliFillBitWindow16(BrotliBitReader* const br) {
-  BrotliFillBitWindow(br, 17);
-}
-
-/* Pulls one byte of input to accumulator. */
-static BROTLI_INLINE BROTLI_BOOL BrotliPullByte(BrotliBitReader* const br) {
-  if (br->avail_in == 0) {
-    return BROTLI_FALSE;
-  }
-  br->val_ >>= 8;
-#if (BROTLI_64_BITS)
-  br->val_ |= ((uint64_t)*br->next_in) << 56;
-#else
-  br->val_ |= ((uint32_t)*br->next_in) << 24;
-#endif
-  br->bit_pos_ -= 8;
-  --br->avail_in;
-  ++br->next_in;
-  return BROTLI_TRUE;
-}
-
-/* Returns currently available bits.
-   The number of valid bits could be calculated by BrotliGetAvailableBits. */
-static BROTLI_INLINE reg_t BrotliGetBitsUnmasked(BrotliBitReader* const br) {
-  return br->val_ >> br->bit_pos_;
-}
-
-/* Like BrotliGetBits, but does not mask the result.
-   The result contains at least 16 valid bits. */
-static BROTLI_INLINE uint32_t BrotliGet16BitsUnmasked(
-    BrotliBitReader* const br) {
-  BrotliFillBitWindow(br, 16);
-  return (uint32_t)BrotliGetBitsUnmasked(br);
-}
-
-/* Returns the specified number of bits from |br| without advancing bit pos. */
-static BROTLI_INLINE uint32_t BrotliGetBits(
-    BrotliBitReader* const br, uint32_t n_bits) {
-  BrotliFillBitWindow(br, n_bits);
-  return (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
-}
-
-/* Tries to peek the specified amount of bits. Returns 0, if there is not
-   enough input. */
-static BROTLI_INLINE BROTLI_BOOL BrotliSafeGetBits(
-    BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
-  while (BrotliGetAvailableBits(br) < n_bits) {
-    if (!BrotliPullByte(br)) {
-      return BROTLI_FALSE;
-    }
-  }
-  *val = (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
-  return BROTLI_TRUE;
-}
-
-/* Advances the bit pos by n_bits. */
-static BROTLI_INLINE void BrotliDropBits(
-    BrotliBitReader* const br, uint32_t n_bits) {
-  br->bit_pos_ += n_bits;
-}
-
-static BROTLI_INLINE void BrotliBitReaderUnload(BrotliBitReader* br) {
-  uint32_t unused_bytes = BrotliGetAvailableBits(br) >> 3;
-  uint32_t unused_bits = unused_bytes << 3;
-  br->avail_in += unused_bytes;
-  br->next_in -= unused_bytes;
-  if (unused_bits == sizeof(br->val_) << 3) {
-    br->val_ = 0;
-  } else {
-    br->val_ <<= unused_bits;
-  }
-  br->bit_pos_ += unused_bits;
-}
-
-/* Reads the specified number of bits from |br| and advances the bit pos.
-   Precondition: accumulator MUST contain at least n_bits. */
-static BROTLI_INLINE void BrotliTakeBits(
-  BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
-  *val = (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
-  BROTLI_LOG(("[BrotliReadBits]  %d %d %d val: %6x\n",
-      (int)br->avail_in, (int)br->bit_pos_, n_bits, (int)*val));
-  BrotliDropBits(br, n_bits);
-}
-
-/* Reads the specified number of bits from |br| and advances the bit pos.
-   Assumes that there is enough input to perform BrotliFillBitWindow. */
-static BROTLI_INLINE uint32_t BrotliReadBits(
-    BrotliBitReader* const br, uint32_t n_bits) {
-  if (BROTLI_64_BITS || (n_bits <= 16)) {
-    uint32_t val;
-    BrotliFillBitWindow(br, n_bits);
-    BrotliTakeBits(br, n_bits, &val);
-    return val;
-  } else {
-    uint32_t low_val;
-    uint32_t high_val;
-    BrotliFillBitWindow(br, 16);
-    BrotliTakeBits(br, 16, &low_val);
-    BrotliFillBitWindow(br, 8);
-    BrotliTakeBits(br, n_bits - 16, &high_val);
-    return low_val | (high_val << 16);
-  }
-}
-
-/* Tries to read the specified amount of bits. Returns 0, if there is not
-   enough input. n_bits MUST be positive. */
-static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits(
-    BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
-  while (BrotliGetAvailableBits(br) < n_bits) {
-    if (!BrotliPullByte(br)) {
-      return BROTLI_FALSE;
-    }
-  }
-  BrotliTakeBits(br, n_bits, val);
-  return BROTLI_TRUE;
-}
-
-/* Advances the bit reader position to the next byte boundary and verifies
-   that any skipped bits are set to zero. */
-static BROTLI_INLINE BROTLI_BOOL BrotliJumpToByteBoundary(BrotliBitReader* br) {
-  uint32_t pad_bits_count = BrotliGetAvailableBits(br) & 0x7;
-  uint32_t pad_bits = 0;
-  if (pad_bits_count != 0) {
-    BrotliTakeBits(br, pad_bits_count, &pad_bits);
-  }
-  return TO_BROTLI_BOOL(pad_bits == 0);
-}
-
-/* Copies remaining input bytes stored in the bit reader to the output. Value
-   num may not be larger than BrotliGetRemainingBytes. The bit reader must be
-   warmed up again after this. */
-static BROTLI_INLINE void BrotliCopyBytes(uint8_t* dest,
-                                          BrotliBitReader* br, size_t num) {
-  while (BrotliGetAvailableBits(br) >= 8 && num > 0) {
-    *dest = (uint8_t)BrotliGetBitsUnmasked(br);
-    BrotliDropBits(br, 8);
-    ++dest;
-    --num;
-  }
-  memcpy(dest, br->next_in, num);
-  br->avail_in -= num;
-  br->next_in += num;
-}
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
-
-#endif  /* BROTLI_DEC_BIT_READER_H_ */
diff --git a/Source/ThirdParty/brotli/dec/context.h b/Source/ThirdParty/brotli/dec/context.h
deleted file mode 100644 (file)
index 9402cbe..0000000
+++ /dev/null
@@ -1,251 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Lookup table to map the previous two bytes to a context id.
-
-   There are four different context modeling modes defined here:
-     CONTEXT_LSB6: context id is the least significant 6 bits of the last byte,
-     CONTEXT_MSB6: context id is the most significant 6 bits of the last byte,
-     CONTEXT_UTF8: second-order context model tuned for UTF8-encoded text,
-     CONTEXT_SIGNED: second-order context model tuned for signed integers.
-
-   The context id for the UTF8 context model is calculated as follows. If p1
-   and p2 are the previous two bytes, we calculate the context as
-
-     context = kContextLookup[p1] | kContextLookup[p2 + 256].
-
-   If the previous two bytes are ASCII characters (i.e. < 128), this will be
-   equivalent to
-
-     context = 4 * context1(p1) + context2(p2),
-
-   where context1 is based on the previous byte in the following way:
-
-     0  : non-ASCII control
-     1  : \t, \n, \r
-     2  : space
-     3  : other punctuation
-     4  : " '
-     5  : %
-     6  : ( < [ {
-     7  : ) > ] }
-     8  : , ; :
-     9  : .
-     10 : =
-     11 : number
-     12 : upper-case vowel
-     13 : upper-case consonant
-     14 : lower-case vowel
-     15 : lower-case consonant
-
-   and context2 is based on the second last byte:
-
-     0 : control, space
-     1 : punctuation
-     2 : upper-case letter, number
-     3 : lower-case letter
-
-   If the last byte is ASCII, and the second last byte is not (in a valid UTF8
-   stream it will be a continuation byte, value between 128 and 191), the
-   context is the same as if the second last byte was an ASCII control or space.
-
-   If the last byte is a UTF8 lead byte (value >= 192), then the next byte will
-   be a continuation byte and the context id is 2 or 3 depending on the LSB of
-   the last byte and to a lesser extent on the second last byte if it is ASCII.
-
-   If the last byte is a UTF8 continuation byte, the second last byte can be:
-     - continuation byte: the next byte is probably ASCII or lead byte (assuming
-       4-byte UTF8 characters are rare) and the context id is 0 or 1.
-     - lead byte (192 - 207): next byte is ASCII or lead byte, context is 0 or 1
-     - lead byte (208 - 255): next byte is continuation byte, context is 2 or 3
-
-   The possible value combinations of the previous two bytes, the range of
-   context ids and the type of the next byte is summarized in the table below:
-
-   |--------\-----------------------------------------------------------------|
-   |         \                         Last byte                              |
-   | Second   \---------------------------------------------------------------|
-   | last byte \    ASCII            |   cont. byte        |   lead byte      |
-   |            \   (0-127)          |   (128-191)         |   (192-)         |
-   |=============|===================|=====================|==================|
-   |  ASCII      | next: ASCII/lead  |  not valid          |  next: cont.     |
-   |  (0-127)    | context: 4 - 63   |                     |  context: 2 - 3  |
-   |-------------|-------------------|---------------------|------------------|
-   |  cont. byte | next: ASCII/lead  |  next: ASCII/lead   |  next: cont.     |
-   |  (128-191)  | context: 4 - 63   |  context: 0 - 1     |  context: 2 - 3  |
-   |-------------|-------------------|---------------------|------------------|
-   |  lead byte  | not valid         |  next: ASCII/lead   |  not valid       |
-   |  (192-207)  |                   |  context: 0 - 1     |                  |
-   |-------------|-------------------|---------------------|------------------|
-   |  lead byte  | not valid         |  next: cont.        |  not valid       |
-   |  (208-)     |                   |  context: 2 - 3     |                  |
-   |-------------|-------------------|---------------------|------------------|
-
-   The context id for the signed context mode is calculated as:
-
-     context = (kContextLookup[512 + p1] << 3) | kContextLookup[512 + p2].
-
-   For any context modeling modes, the context ids can be calculated by |-ing
-   together two lookups from one table using context model dependent offsets:
-
-     context = kContextLookup[offset1 + p1] | kContextLookup[offset2 + p2].
-
-   where offset1 and offset2 are dependent on the context mode.
-*/
-
-#ifndef BROTLI_DEC_CONTEXT_H_
-#define BROTLI_DEC_CONTEXT_H_
-
-#include <brotli/types.h>
-
-enum ContextType {
-  CONTEXT_LSB6 = 0,
-  CONTEXT_MSB6 = 1,
-  CONTEXT_UTF8 = 2,
-  CONTEXT_SIGNED = 3
-};
-
-/* Common context lookup table for all context modes. */
-static const uint8_t kContextLookup[1792] = {
-  /* CONTEXT_UTF8, last byte. */
-  /* ASCII range. */
-   0,  0,  0,  0,  0,  0,  0,  0,  0,  4,  4,  0,  0,  4,  0,  0,
-   0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
-   8, 12, 16, 12, 12, 20, 12, 16, 24, 28, 12, 12, 32, 12, 36, 12,
-  44, 44, 44, 44, 44, 44, 44, 44, 44, 44, 32, 32, 24, 40, 28, 12,
-  12, 48, 52, 52, 52, 48, 52, 52, 52, 48, 52, 52, 52, 52, 52, 48,
-  52, 52, 52, 52, 52, 48, 52, 52, 52, 52, 52, 24, 12, 28, 12, 12,
-  12, 56, 60, 60, 60, 56, 60, 60, 60, 56, 60, 60, 60, 60, 60, 56,
-  60, 60, 60, 60, 60, 56, 60, 60, 60, 60, 60, 24, 12, 28, 12,  0,
-  /* UTF8 continuation byte range. */
-  0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
-  0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
-  0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
-  0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
-  /* UTF8 lead byte range. */
-  2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
-  2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
-  2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
-  2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
-  /* CONTEXT_UTF8 second last byte. */
-  /* ASCII range. */
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1, 1,
-  1, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1,
-  1, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
-  3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 1, 1, 1, 1, 0,
-  /* UTF8 continuation byte range. */
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  /* UTF8 lead byte range. */
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  /* CONTEXT_SIGNED, second last byte. */
-  0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-  3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
-  3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
-  3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
-  3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
-  4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
-  4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
-  4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
-  4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
-  5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
-  5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
-  5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
-  6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 7,
-  /* CONTEXT_SIGNED, last byte, same as the above values shifted by 3 bits. */
-   0, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8,
-  16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
-  16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
-  16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
-  24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
-  24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
-  24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
-  24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
-  32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
-  32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
-  32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
-  32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
-  40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
-  40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
-  40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
-  48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 56,
-  /* CONTEXT_LSB6, last byte. */
-   0,  1,  2,  3,  4,  5,  6,  7,  8,  9, 10, 11, 12, 13, 14, 15,
-  16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
-  32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
-  48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
-   0,  1,  2,  3,  4,  5,  6,  7,  8,  9, 10, 11, 12, 13, 14, 15,
-  16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
-  32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
-  48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
-   0,  1,  2,  3,  4,  5,  6,  7,  8,  9, 10, 11, 12, 13, 14, 15,
-  16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
-  32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
-  48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
-   0,  1,  2,  3,  4,  5,  6,  7,  8,  9, 10, 11, 12, 13, 14, 15,
-  16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
-  32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
-  48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
-  /* CONTEXT_MSB6, last byte. */
-   0,  0,  0,  0,  1,  1,  1,  1,  2,  2,  2,  2,  3,  3,  3,  3,
-   4,  4,  4,  4,  5,  5,  5,  5,  6,  6,  6,  6,  7,  7,  7,  7,
-   8,  8,  8,  8,  9,  9,  9,  9, 10, 10, 10, 10, 11, 11, 11, 11,
-  12, 12, 12, 12, 13, 13, 13, 13, 14, 14, 14, 14, 15, 15, 15, 15,
-  16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, 19, 19, 19, 19,
-  20, 20, 20, 20, 21, 21, 21, 21, 22, 22, 22, 22, 23, 23, 23, 23,
-  24, 24, 24, 24, 25, 25, 25, 25, 26, 26, 26, 26, 27, 27, 27, 27,
-  28, 28, 28, 28, 29, 29, 29, 29, 30, 30, 30, 30, 31, 31, 31, 31,
-  32, 32, 32, 32, 33, 33, 33, 33, 34, 34, 34, 34, 35, 35, 35, 35,
-  36, 36, 36, 36, 37, 37, 37, 37, 38, 38, 38, 38, 39, 39, 39, 39,
-  40, 40, 40, 40, 41, 41, 41, 41, 42, 42, 42, 42, 43, 43, 43, 43,
-  44, 44, 44, 44, 45, 45, 45, 45, 46, 46, 46, 46, 47, 47, 47, 47,
-  48, 48, 48, 48, 49, 49, 49, 49, 50, 50, 50, 50, 51, 51, 51, 51,
-  52, 52, 52, 52, 53, 53, 53, 53, 54, 54, 54, 54, 55, 55, 55, 55,
-  56, 56, 56, 56, 57, 57, 57, 57, 58, 58, 58, 58, 59, 59, 59, 59,
-  60, 60, 60, 60, 61, 61, 61, 61, 62, 62, 62, 62, 63, 63, 63, 63,
-  /* CONTEXT_{M,L}SB6, second last byte, */
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-  0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-};
-
-static const int kContextLookupOffsets[8] = {
-  /* CONTEXT_LSB6 */
-  1024, 1536,
-  /* CONTEXT_MSB6 */
-  1280, 1536,
-  /* CONTEXT_UTF8 */
-  0, 256,
-  /* CONTEXT_SIGNED */
-  768, 512,
-};
-
-#endif  /* BROTLI_DEC_CONTEXT_H_ */
diff --git a/Source/ThirdParty/brotli/dec/decode.c b/Source/ThirdParty/brotli/dec/decode.c
deleted file mode 100644 (file)
index be8de42..0000000
+++ /dev/null
@@ -1,2380 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-#include <brotli/decode.h>
-
-#ifdef __ARM_NEON__
-#include <arm_neon.h>
-#endif
-
-#include <stdlib.h>  /* free, malloc */
-#include <string.h>  /* memcpy, memset */
-
-#include "../common/constants.h"
-#include "../common/dictionary.h"
-#include "../common/version.h"
-#include "./bit_reader.h"
-#include "./context.h"
-#include "./huffman.h"
-#include "./port.h"
-#include "./prefix.h"
-#include "./state.h"
-#include "./transform.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-#define BROTLI_FAILURE(CODE) (BROTLI_DUMP(), CODE)
-
-#define BROTLI_LOG_UINT(name)                                       \
-  BROTLI_LOG(("[%s] %s = %lu\n", __func__, #name, (unsigned long)(name)))
-#define BROTLI_LOG_ARRAY_INDEX(array_name, idx)                     \
-  BROTLI_LOG(("[%s] %s[%lu] = %lu\n", __func__, #array_name,        \
-         (unsigned long)(idx), (unsigned long)array_name[idx]))
-
-#define HUFFMAN_TABLE_BITS 8U
-#define HUFFMAN_TABLE_MASK 0xff
-
-/* We need the slack region for the following reasons:
-    - doing up to two 16-byte copies for fast backward copying
-    - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
-static const uint32_t kRingBufferWriteAheadSlack = 42;
-
-static const uint8_t kCodeLengthCodeOrder[BROTLI_CODE_LENGTH_CODES] = {
-  1, 2, 3, 4, 0, 5, 17, 6, 16, 7, 8, 9, 10, 11, 12, 13, 14, 15,
-};
-
-/* Static prefix code for the complex code length code lengths. */
-static const uint8_t kCodeLengthPrefixLength[16] = {
-  2, 2, 2, 3, 2, 2, 2, 4, 2, 2, 2, 3, 2, 2, 2, 4,
-};
-
-static const uint8_t kCodeLengthPrefixValue[16] = {
-  0, 4, 3, 2, 0, 4, 3, 1, 0, 4, 3, 2, 0, 4, 3, 5,
-};
-
-BROTLI_BOOL BrotliDecoderSetParameter(
-    BrotliDecoderState* state, BrotliDecoderParameter p, uint32_t value) {
-  switch (p) {
-    case BROTLI_DECODER_PARAM_DISABLE_RING_BUFFER_REALLOCATION:
-      state->canny_ringbuffer_allocation = !!value ? 0 : 1;
-      return BROTLI_TRUE;
-
-    default: return BROTLI_FALSE;
-  }
-}
-
-BrotliDecoderState* BrotliDecoderCreateInstance(
-    brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque) {
-  BrotliDecoderState* state = 0;
-  if (!alloc_func && !free_func) {
-    state = (BrotliDecoderState*)malloc(sizeof(BrotliDecoderState));
-  } else if (alloc_func && free_func) {
-    state = (BrotliDecoderState*)alloc_func(opaque, sizeof(BrotliDecoderState));
-  }
-  if (state == 0) {
-    BROTLI_DUMP();
-    return 0;
-  }
-  BrotliDecoderStateInitWithCustomAllocators(
-      state, alloc_func, free_func, opaque);
-  return state;
-}
-
-/* Deinitializes and frees BrotliDecoderState instance. */
-void BrotliDecoderDestroyInstance(BrotliDecoderState* state) {
-  if (!state) {
-    return;
-  } else {
-    brotli_free_func free_func = state->free_func;
-    void* opaque = state->memory_manager_opaque;
-    BrotliDecoderStateCleanup(state);
-    free_func(opaque, state);
-  }
-}
-
-/* Saves error code and converts it to BrotliDecoderResult */
-static BROTLI_NOINLINE BrotliDecoderResult SaveErrorCode(
-    BrotliDecoderState* s, BrotliDecoderErrorCode e) {
-  s->error_code = (int)e;
-  switch (e) {
-    case BROTLI_DECODER_SUCCESS:
-      return BROTLI_DECODER_RESULT_SUCCESS;
-    case BROTLI_DECODER_NEEDS_MORE_INPUT:
-      return BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT;
-    case BROTLI_DECODER_NEEDS_MORE_OUTPUT:
-      return BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT;
-    default:
-      return BROTLI_DECODER_RESULT_ERROR;
-  }
-}
-
-/* Decodes a number in the range [9..24], by reading 1 - 7 bits.
-   Precondition: bit-reader accumulator has at least 7 bits. */
-static uint32_t DecodeWindowBits(BrotliBitReader* br) {
-  uint32_t n;
-  BrotliTakeBits(br, 1, &n);
-  if (n == 0) {
-    return 16;
-  }
-  BrotliTakeBits(br, 3, &n);
-  if (n != 0) {
-    return 17 + n;
-  }
-  BrotliTakeBits(br, 3, &n);
-  if (n != 0) {
-    return 8 + n;
-  }
-  return 17;
-}
-
-static BROTLI_INLINE void memmove16(uint8_t* dst, uint8_t* src) {
-#if defined(__ARM_NEON__)
-  vst1q_u8(dst, vld1q_u8(src));
-#else
-  uint32_t buffer[4];
-  memcpy(buffer, src, 16);
-  memcpy(dst, buffer, 16);
-#endif
-}
-
-/* Decodes a number in the range [0..255], by reading 1 - 11 bits. */
-static BROTLI_NOINLINE BrotliDecoderErrorCode DecodeVarLenUint8(
-    BrotliDecoderState* s, BrotliBitReader* br, uint32_t* value) {
-  uint32_t bits;
-  switch (s->substate_decode_uint8) {
-    case BROTLI_STATE_DECODE_UINT8_NONE:
-      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 1, &bits))) {
-        return BROTLI_DECODER_NEEDS_MORE_INPUT;
-      }
-      if (bits == 0) {
-        *value = 0;
-        return BROTLI_DECODER_SUCCESS;
-      }
-      /* No break, transit to the next state. */
-
-    case BROTLI_STATE_DECODE_UINT8_SHORT:
-      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 3, &bits))) {
-        s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_SHORT;
-        return BROTLI_DECODER_NEEDS_MORE_INPUT;
-      }
-      if (bits == 0) {
-        *value = 1;
-        s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
-        return BROTLI_DECODER_SUCCESS;
-      }
-      /* Use output value as a temporary storage. It MUST be persisted. */
-      *value = bits;
-      /* No break, transit to the next state. */
-
-    case BROTLI_STATE_DECODE_UINT8_LONG:
-      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, *value, &bits))) {
-        s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_LONG;
-        return BROTLI_DECODER_NEEDS_MORE_INPUT;
-      }
-      *value = (1U << *value) + bits;
-      s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
-      return BROTLI_DECODER_SUCCESS;
-
-    default:
-      return
-          BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
-  }
-}
-
-/* Decodes a metablock length and flags by reading 2 - 31 bits. */
-static BrotliDecoderErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
-    BrotliDecoderState* s, BrotliBitReader* br) {
-  uint32_t bits;
-  int i;
-  for (;;) {
-    switch (s->substate_metablock_header) {
-      case BROTLI_STATE_METABLOCK_HEADER_NONE:
-        if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_DECODER_NEEDS_MORE_INPUT;
-        }
-        s->is_last_metablock = bits ? 1 : 0;
-        s->meta_block_remaining_len = 0;
-        s->is_uncompressed = 0;
-        s->is_metadata = 0;
-        if (!s->is_last_metablock) {
-          s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NIBBLES;
-          break;
-        }
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_EMPTY;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_EMPTY:
-        if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_DECODER_NEEDS_MORE_INPUT;
-        }
-        if (bits) {
-          s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-          return BROTLI_DECODER_SUCCESS;
-        }
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NIBBLES;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_NIBBLES:
-        if (!BrotliSafeReadBits(br, 2, &bits)) {
-          return BROTLI_DECODER_NEEDS_MORE_INPUT;
-        }
-        s->size_nibbles = (uint8_t)(bits + 4);
-        s->loop_counter = 0;
-        if (bits == 3) {
-          s->is_metadata = 1;
-          s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_RESERVED;
-          break;
-        }
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_SIZE;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_SIZE:
-        i = s->loop_counter;
-        for (; i < (int)s->size_nibbles; ++i) {
-          if (!BrotliSafeReadBits(br, 4, &bits)) {
-            s->loop_counter = i;
-            return BROTLI_DECODER_NEEDS_MORE_INPUT;
-          }
-          if (i + 1 == s->size_nibbles && s->size_nibbles > 4 && bits == 0) {
-            return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_NIBBLE);
-          }
-          s->meta_block_remaining_len |= (int)(bits << (i * 4));
-        }
-        s->substate_metablock_header =
-            BROTLI_STATE_METABLOCK_HEADER_UNCOMPRESSED;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_UNCOMPRESSED:
-        if (!s->is_last_metablock) {
-          if (!BrotliSafeReadBits(br, 1, &bits)) {
-            return BROTLI_DECODER_NEEDS_MORE_INPUT;
-          }
-          s->is_uncompressed = bits ? 1 : 0;
-        }
-        ++s->meta_block_remaining_len;
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-        return BROTLI_DECODER_SUCCESS;
-
-      case BROTLI_STATE_METABLOCK_HEADER_RESERVED:
-        if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_DECODER_NEEDS_MORE_INPUT;
-        }
-        if (bits != 0) {
-          return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_RESERVED);
-        }
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_BYTES;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_BYTES:
-        if (!BrotliSafeReadBits(br, 2, &bits)) {
-          return BROTLI_DECODER_NEEDS_MORE_INPUT;
-        }
-        if (bits == 0) {
-          s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-          return BROTLI_DECODER_SUCCESS;
-        }
-        s->size_nibbles = (uint8_t)bits;
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_METADATA;
-        /* No break, transit to the next state. */
-
-      case BROTLI_STATE_METABLOCK_HEADER_METADATA:
-        i = s->loop_counter;
-        for (; i < (int)s->size_nibbles; ++i) {
-          if (!BrotliSafeReadBits(br, 8, &bits)) {
-            s->loop_counter = i;
-            return BROTLI_DECODER_NEEDS_MORE_INPUT;
-          }
-          if (i + 1 == s->size_nibbles && s->size_nibbles > 1 && bits == 0) {
-            return BROTLI_FAILURE(
-                BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
-          }
-          s->meta_block_remaining_len |= (int)(bits << (i * 8));
-        }
-        ++s->meta_block_remaining_len;
-        s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-        return BROTLI_DECODER_SUCCESS;
-
-      default:
-        return
-            BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
-    }
-  }
-}
-
-/* Decodes the Huffman code.
-   This method doesn't read data from the bit reader, BUT drops the amount of
-   bits that correspond to the decoded symbol.
-   bits MUST contain at least 15 (BROTLI_HUFFMAN_MAX_CODE_LENGTH) valid bits. */
-static BROTLI_INLINE uint32_t DecodeSymbol(uint32_t bits,
-                                           const HuffmanCode* table,
-                                           BrotliBitReader* br) {
-  table += bits & HUFFMAN_TABLE_MASK;
-  if (table->bits > HUFFMAN_TABLE_BITS) {
-    uint32_t nbits = table->bits - HUFFMAN_TABLE_BITS;
-    BrotliDropBits(br, HUFFMAN_TABLE_BITS);
-    table += table->value;
-    table += (bits >> HUFFMAN_TABLE_BITS) & BitMask(nbits);
-  }
-  BrotliDropBits(br, table->bits);
-  return table->value;
-}
-
-/* Reads and decodes the next Huffman code from bit-stream.
-   This method peeks 16 bits of input and drops 0 - 15 of them. */
-static BROTLI_INLINE uint32_t ReadSymbol(const HuffmanCode* table,
-                                         BrotliBitReader* br) {
-  return DecodeSymbol(BrotliGet16BitsUnmasked(br), table, br);
-}
-
-/* Same as DecodeSymbol, but it is known that there is less than 15 bits of
-   input are currently available. */
-static BROTLI_NOINLINE BROTLI_BOOL SafeDecodeSymbol(
-    const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
-  uint32_t val;
-  uint32_t available_bits = BrotliGetAvailableBits(br);
-  if (available_bits == 0) {
-    if (table->bits == 0) {
-      *result = table->value;
-      return BROTLI_TRUE;
-    }
-    return BROTLI_FALSE; /* No valid bits at all. */
-  }
-  val = (uint32_t)BrotliGetBitsUnmasked(br);
-  table += val & HUFFMAN_TABLE_MASK;
-  if (table->bits <= HUFFMAN_TABLE_BITS) {
-    if (table->bits <= available_bits) {
-      BrotliDropBits(br, table->bits);
-      *result = table->value;
-      return BROTLI_TRUE;
-    } else {
-      return BROTLI_FALSE; /* Not enough bits for the first level. */
-    }
-  }
-  if (available_bits <= HUFFMAN_TABLE_BITS) {
-    return BROTLI_FALSE; /* Not enough bits to move to the second level. */
-  }
-
-  /* Speculatively drop HUFFMAN_TABLE_BITS. */
-  val = (val & BitMask(table->bits)) >> HUFFMAN_TABLE_BITS;
-  available_bits -= HUFFMAN_TABLE_BITS;
-  table += table->value + val;
-  if (available_bits < table->bits) {
-    return BROTLI_FALSE; /* Not enough bits for the second level. */
-  }
-
-  BrotliDropBits(br, HUFFMAN_TABLE_BITS + table->bits);
-  *result = table->value;
-  return BROTLI_TRUE;
-}
-
-static BROTLI_INLINE BROTLI_BOOL SafeReadSymbol(
-    const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
-  uint32_t val;
-  if (BROTLI_PREDICT_TRUE(BrotliSafeGetBits(br, 15, &val))) {
-    *result = DecodeSymbol(val, table, br);
-    return BROTLI_TRUE;
-  }
-  return SafeDecodeSymbol(table, br, result);
-}
-
-/* Makes a look-up in first level Huffman table. Peeks 8 bits. */
-static BROTLI_INLINE void PreloadSymbol(int safe,
-                                        const HuffmanCode* table,
-                                        BrotliBitReader* br,
-                                        uint32_t* bits,
-                                        uint32_t* value) {
-  if (safe) {
-    return;
-  }
-  table += BrotliGetBits(br, HUFFMAN_TABLE_BITS);
-  *bits = table->bits;
-  *value = table->value;
-}
-
-/* Decodes the next Huffman code using data prepared by PreloadSymbol.
-   Reads 0 - 15 bits. Also peeks 8 following bits. */
-static BROTLI_INLINE uint32_t ReadPreloadedSymbol(const HuffmanCode* table,
-                                                  BrotliBitReader* br,
-                                                  uint32_t* bits,
-                                                  uint32_t* value) {
-  uint32_t result = *value;
-  if (BROTLI_PREDICT_FALSE(*bits > HUFFMAN_TABLE_BITS)) {
-    uint32_t val = BrotliGet16BitsUnmasked(br);
-    const HuffmanCode* ext = table + (val & HUFFMAN_TABLE_MASK) + *value;
-    uint32_t mask = BitMask((*bits - HUFFMAN_TABLE_BITS));
-    BrotliDropBits(br, HUFFMAN_TABLE_BITS);
-    ext += (val >> HUFFMAN_TABLE_BITS) & mask;
-    BrotliDropBits(br, ext->bits);
-    result = ext->value;
-  } else {
-    BrotliDropBits(br, *bits);
-  }
-  PreloadSymbol(0, table, br, bits, value);
-  return result;
-}
-
-static BROTLI_INLINE uint32_t Log2Floor(uint32_t x) {
-  uint32_t result = 0;
-  while (x) {
-    x >>= 1;
-    ++result;
-  }
-  return result;
-}
-
-/* Reads (s->symbol + 1) symbols.
-   Totally 1..4 symbols are read, 1..10 bits each.
-   The list of symbols MUST NOT contain duplicates.
- */
-static BrotliDecoderErrorCode ReadSimpleHuffmanSymbols(
-    uint32_t alphabet_size, BrotliDecoderState* s) {
-  /* max_bits == 1..10; symbol == 0..3; 1..40 bits will be read. */
-  BrotliBitReader* br = &s->br;
-  uint32_t max_bits = Log2Floor(alphabet_size - 1);
-  uint32_t i = s->sub_loop_counter;
-  uint32_t num_symbols = s->symbol;
-  while (i <= num_symbols) {
-    uint32_t v;
-    if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
-      s->sub_loop_counter = i;
-      s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_READ;
-      return BROTLI_DECODER_NEEDS_MORE_INPUT;
-    }
-    if (v >= alphabet_size) {
-      return
-          BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
-    }
-    s->symbols_lists_array[i] = (uint16_t)v;
-    BROTLI_LOG_UINT(s->symbols_lists_array[i]);
-    ++i;
-  }
-
-  for (i = 0; i < num_symbols; ++i) {
-    uint32_t k = i + 1;
-    for (; k <= num_symbols; ++k) {
-      if (s->symbols_lists_array[i] == s->symbols_lists_array[k]) {
-        return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
-      }
-    }
-  }
-
-  return BROTLI_DECODER_SUCCESS;
-}
-
-/* Process single decoded symbol code length:
-    A) reset the repeat variable
-    B) remember code length (if it is not 0)
-    C) extend corresponding index-chain
-    D) reduce the Huffman space
-    E) update the histogram
- */
-static BROTLI_INLINE void ProcessSingleCodeLength(uint32_t code_len,
-    uint32_t* symbol, uint32_t* repeat, uint32_t* space,
-    uint32_t* prev_code_len, uint16_t* symbol_lists,
-    uint16_t* code_length_histo, int* next_symbol) {
-  *repeat = 0;
-  if (code_len != 0) { /* code_len == 1..15 */
-    symbol_lists[next_symbol[code_len]] = (uint16_t)(*symbol);
-    next_symbol[code_len] = (int)(*symbol);
-    *prev_code_len = code_len;
-    *space -= 32768U >> code_len;
-    code_length_histo[code_len]++;
-    BROTLI_LOG(("[ReadHuffmanCode] code_length[%d] = %d\n", *symbol, code_len));
-  }
-  (*symbol)++;
-}
-
-/* Process repeated symbol code length.
-    A) Check if it is the extension of previous repeat sequence; if the decoded
-       value is not BROTLI_REPEAT_PREVIOUS_CODE_LENGTH, then it is a new
-       symbol-skip
-    B) Update repeat variable
-    C) Check if operation is feasible (fits alphabet)
-    D) For each symbol do the same operations as in ProcessSingleCodeLength
-
-   PRECONDITION: code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH or
-                 code_len == BROTLI_REPEAT_ZERO_CODE_LENGTH
- */
-static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
-    uint32_t repeat_delta, uint32_t alphabet_size, uint32_t* symbol,
-    uint32_t* repeat, uint32_t* space, uint32_t* prev_code_len,
-    uint32_t* repeat_code_len, uint16_t* symbol_lists,
-    uint16_t* code_length_histo, int* next_symbol) {
-  uint32_t old_repeat;
-  uint32_t extra_bits = 3;  /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
-  uint32_t new_len = 0;  /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
-  if (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
-    new_len = *prev_code_len;
-    extra_bits = 2;
-  }
-  if (*repeat_code_len != new_len) {
-    *repeat = 0;
-    *repeat_code_len = new_len;
-  }
-  old_repeat = *repeat;
-  if (*repeat > 0) {
-    *repeat -= 2;
-    *repeat <<= extra_bits;
-  }
-  *repeat += repeat_delta + 3U;
-  repeat_delta = *repeat - old_repeat;
-  if (*symbol + repeat_delta > alphabet_size) {
-    BROTLI_DUMP();
-    *symbol = alphabet_size;
-    *space = 0xFFFFF;
-    return;
-  }
-  BROTLI_LOG(("[ReadHuffmanCode] code_length[%d..%d] = %d\n",
-              *symbol, *symbol + repeat_delta - 1, *repeat_code_len));
-  if (*repeat_code_len != 0) {
-    unsigned last = *symbol + repeat_delta;
-    int next = next_symbol[*repeat_code_len];
-    do {
-      symbol_lists[next] = (uint16_t)*symbol;
-      next = (int)*symbol;
-    } while (++(*symbol) != last);
-    next_symbol[*repeat_code_len] = next;
-    *space -= repeat_delta << (15 - *repeat_code_len);
-    code_length_histo[*repeat_code_len] =
-        (uint16_t)(code_length_histo[*repeat_code_len] + repeat_delta);
-  } else {
-    *symbol += repeat_delta;
-  }
-}
-
-/* Reads and decodes symbol codelengths. */
-static BrotliDecoderErrorCode ReadSymbolCodeLengths(
-    uint32_t alphabet_size, BrotliDecoderState* s) {
-  BrotliBitReader* br = &s->br;
-  uint32_t symbol = s->symbol;
-  uint32_t repeat = s->repeat;
-  uint32_t space = s->space;
-  uint32_t prev_code_len = s->prev_code_len;
-  uint32_t repeat_code_len = s->repeat_code_len;
-  uint16_t* symbol_lists = s->symbol_lists;
-  uint16_t* code_length_histo = s->code_length_histo;
-  int* next_symbol = s->next_symbol;
-  if (!BrotliWarmupBitReader(br)) {
-    return BROTLI_DECODER_NEEDS_MORE_INPUT;
-  }
-  while (symbol < alphabet_size && space > 0) {
-    const HuffmanCode* p = s->table;
-    uint32_t code_len;
-    if (!BrotliCheckInputAmount(br, BROTLI_SHORT_FILL_BIT_WINDOW_READ)) {
-      s->symbol = symbol;
-      s->repeat = repeat;
-      s->prev_code_len = prev_code_len;
-      s->repeat_code_len = repeat_code_len;
-      s->space = space;
-      return BROTLI_DECODER_NEEDS_MORE_INPUT;
-    }
-    BrotliFillBitWindow16(br);
-    p += BrotliGetBitsUnmasked(br) &
-        BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
-    BrotliDropBits(br, p->bits);  /* Use 1..5 bits */
-    code_len = p->value;  /* code_len == 0..17 */
-    if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
-      ProcessSingleCodeLength(code_len, &symbol, &repeat, &space,
-          &prev_code_len, symbol_lists, code_length_histo, next_symbol);
-    } else { /* code_len == 16..17, extra_bits == 2..3 */
-      uint32_t extra_bits =
-          (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) ? 2 : 3;
-      uint32_t repeat_delta =
-          (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(extra_bits);
-      BrotliDropBits(br, extra_bits);
-      ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
-          &symbol, &repeat, &space, &prev_code_len, &repeat_code_len,
-          symbol_lists, code_length_histo, next_symbol);
-    }
-  }
-  s->space = space;
-  return BROTLI_DECODER_SUCCESS;
-}
-
-static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
-    uint32_t alphabet_size, BrotliDecoderState* s) {
-  BrotliBitReader* br = &s->br;
-  BROTLI_BOOL get_byte = BROTLI_FALSE;
-  while (s->symbol < alphabet_size && s->space > 0) {
-    const HuffmanCode* p = s->table;
-    uint32_t code_len;
-    uint32_t available_bits;
-    uint32_t bits = 0;
-    if (get_byte && !BrotliPullByte(br)) return BROTLI_DECODER_NEEDS_MORE_INPUT;
-    get_byte = BROTLI_FALSE;
-    available_bits = BrotliGetAvailableBits(br);
-    if (available_bits != 0) {
-      bits = (uint32_t)BrotliGetBitsUnmasked(br);
-    }
-    p += bits & BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
-    if (p->bits > available_bits) {
-      get_byte = BROTLI_TRUE;
-      continue;
-    }
-    code_len = p->value; /* code_len == 0..17 */
-    if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
-      BrotliDropBits(br, p->bits);
-      ProcessSingleCodeLength(code_len, &s->symbol, &s->repeat, &s->space,
-          &s->prev_code_len, s->symbol_lists, s->code_length_histo,
-          s->next_symbol);
-    } else { /* code_len == 16..17, extra_bits == 2..3 */
-      uint32_t extra_bits = code_len - 14U;
-      uint32_t repeat_delta = (bits >> p->bits) & BitMask(extra_bits);
-      if (available_bits < p->bits + extra_bits) {
-        get_byte = BROTLI_TRUE;
-        continue;
-      }
-      BrotliDropBits(br, p->bits + extra_bits);
-      ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
-          &s->symbol, &s->repeat, &s->space, &s->prev_code_len,
-          &s->repeat_code_len, s->symbol_lists, s->code_length_histo,
-          s->next_symbol);
-    }
-  }
-  return BROTLI_DECODER_SUCCESS;
-}
-
-/* Reads and decodes 15..18 codes using static prefix code.
-   Each code is 2..4 bits long. In total 30..72 bits are used. */
-static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
-  BrotliBitReader* br = &s->br;
-  uint32_t num_codes = s->repeat;
-  unsigned space = s->space;
-  uint32_t i = s->sub_loop_counter;
-  for (; i < BROTLI_CODE_LENGTH_CODES; ++i) {
-    const uint8_t code_len_idx = kCodeLengthCodeOrder[i];
-    uint32_t ix;
-    uint32_t v;
-    if (BROTLI_PREDICT_FALSE(!BrotliSafeGetBits(br, 4, &ix))) {
-      uint32_t available_bits = BrotliGetAvailableBits(br);
-      if (available_bits != 0) {
-        ix = BrotliGetBitsUnmasked(br) & 0xF;
-      } else {
-        ix = 0;
-      }
-      if (kCodeLengthPrefixLength[ix] > available_bits) {
-        s->sub_loop_counter = i;
-        s->repeat = num_codes;
-        s->space = space;
-        s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
-        return BROTLI_DECODER_NEEDS_MORE_INPUT;
-      }
-    }
-    v = kCodeLengthPrefixValue[ix];
-    BrotliDropBits(br, kCodeLengthPrefixLength[ix]);
-    s->code_length_code_lengths[code_len_idx] = (uint8_t)v;
-    BROTLI_LOG_ARRAY_INDEX(s->code_length_code_lengths, code_len_idx);
-    if (v != 0) {
-      space = space - (32U >> v);
-      ++num_codes;
-      ++s->code_length_histo[v];
-      if (space - 1U >= 32U) {
-        /* space is 0 or wrapped around */
-        break;
-      }
-    }
-  }
-  if (!(num_codes == 1 || space == 0)) {
-    return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_CL_SPACE);
-  }
-  return BROTLI_DECODER_SUCCESS;
-}
-
-/* Decodes the Huffman tables.
-   There are 2 scenarios:
-    A) Huffman code contains only few symbols (1..4). Those symbols are read
-       directly; their code lengths are defined by the number of symbols.
-       For this scenario 4 - 45 bits will be read.
-
-    B) 2-phase decoding:
-    B.1) Small Huffman table is decoded; it is specified with code lengths
-         encoded with predefined entropy code. 32 - 74 bits are used.
-    B.2) Decoded table is used to decode code lengths of symbols in resulting
-         Huffman table. In worst case 3520 bits are read.
-*/
-static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
-                                              HuffmanCode* table,
-                                              uint32_t* opt_table_size,
-                                              BrotliDecoderState* s) {
-  BrotliBitReader* br = &s->br;
-  /* Unnecessary masking, but might be good for safety. */
-  alphabet_size &= 0x3ff;
-  /* State machine */
-  for&